KEGG   Homo sapiens (human): 374882Help
Entry
374882            CDS       T01001                                 

Gene name
TMEM205, UNQ501
Definition
(RefSeq) transmembrane protein 205
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4149 PhyH
Motif
Other DBs
NCBI-GeneID: 374882
NCBI-ProteinID: NP_001138888
OMIM: 613771
HGNC: 29631
Ensembl: ENSG00000105518
Vega: OTTHUMG00000182021
Pharos: Q6UW68(Tdark)
UniProt: Q6UW68 A0A024R7D3
Position
19p13.2
AA seq 189 aa AA seqDB search
MEEGGNLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI
SMGCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTV
EKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLA
GLALEIRSL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggcgggaacctaggaggcctgattaagatggtccatctactggtcttgtca
ggtgcctggggcatgcaaatgtgggtgaccttcgtctcaggcttcctgcttttccgaagc
cttccccgacataccttcggactagtgcagagcaaactcttccccttctacttccacatc
tccatgggctgtgccttcatcaacctctgcatcttggcttcacagcatgcttgggctcag
ctcacattctgggaggccagccagctttacctgctgttcctgagccttacgctggccact
gtcaacgcccgctggctggaaccccgcaccacagctgccatgtgggccctgcaaaccgtg
gagaaggagcgaggcctgggtggggaggtaccaggcagccaccagggtcccgatccctac
cgccagctgcgagagaaggaccccaagtacagtgctctccgccagaatttcttccgctac
catgggctgtcctctctttgcaatctgggctgcgtcctgagcaatgggctctgtctcgct
ggccttgccctggaaataaggagcctctag

DBGET integrated database retrieval system