KEGG   Homo sapiens (human): 3749Help
Entry
3749              CDS       T01001                                 

Gene name
KCNC4, C1orf30, HKSHIIIC, KSHIIIC, KV3.4
Definition
(RefSeq) potassium voltage-gated channel subfamily C member 4
  KO
K04890  potassium voltage-gated channel Shaw-related subfamily C member 4
Organism
hsa  Homo sapiens (human)
Drug target
Amifampridine: D10228 D10689
Fampridine: D04127
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3749 (KCNC4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3749 (KCNC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Potassium_chann Ion_trans_2 BTB_3
Motif
Other DBs
NCBI-GeneID: 3749
NCBI-ProteinID: NP_004969
OMIM: 176265
HGNC: 6236
Ensembl: ENSG00000116396
Vega: OTTHUMG00000011037
Pharos: Q03721(Tclin)
UniProt: Q03721
Structure
PDB: 

Position
1p13.3
AA seq 635 aa AA seqDB search
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT
RLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPAD
VCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDD
ERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSI
TTFCLETHEAFNIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRI
VCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKL
TRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDF
KNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYS
LAMAKQKLPKKRKKHVPRPAQLESPMYCKSEETSPRDSTCSDTSPPAREEGMIERKRADS
KQNGDANAVLSDEEGAGLTQPLASSPTPEERRALRRSTTRDRNKKAAACFLLSTGDYACA
DGSVRKGTFVLRDLPLQHSPEAACPPTAGTLFLPH
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgatcagctcggtgtgtgtctcctcctaccgcgggcgcaagtcggggaacaagcctccg
tccaaaacatgtctgaaggaggagatggccaagggcgaggcgtcggagaagatcatcatc
aacgtgggcggcacgcgacatgagacctaccgcagcaccctgcgcaccctaccgggaacc
cgcctcgcctggctggccgaccccgacggcgggggccggcccgagaccgatggcggcggt
gtgggtagcagcggcagcagcggcggcgggggctgcgagttcttcttcgacaggcacccg
ggcgtcttcgcctacgtgctcaactactaccgcaccggcaagctgcactgccccgcggac
gtgtgcgggccgctcttcgaagaggagctcaccttctggggcatcgacgagaccgacgtg
gaaccctgctgctggatgacctaccggcagcaccgcgacgccgaggaggcgctcgacatc
ttcgagagcccggacggaggcggcagcggcgcggggcccagcgacgaggccggcgacgat
gagcgggagctggccctgcagcgactgggcccccacgagggaggcgcgggccatggcgcc
gggtctgggggctgccgcggctggcagccccgcatgtgggcgctcttcgaggatccctac
tcctcccgggccgctagggtagtggcctttgcctctctcttcttcatcctggtctccatc
accactttctgcctggagacccatgaggcctttaatatcgaccgcaacgtgacagagatc
ctccgcgtagggaacatcaccagcgtgcacttccggcgggaggtagagacagagcccatc
ctgacctacatcgagggcgtatgtgtgctgtggttcacactggagttcctggtgcgcatc
gtgtgctgccccgacacgctggacttcgtcaagaacctgctcaacatcatcgactttgtg
gccatcctgcccttctacctggaggtggggctgagcggcctgtcatccaaggcggcccgc
gacgtgctgggcttcctgcgcgtggtgcgcttcgtgcgcatcctgcgtatcttcaagctc
acacgccacttcgtggggctacgcgtgctgggccacaccctgagggccagcaccaatgag
ttcctgctgcttatcatcttcctggccctgggtgtgctcatctttgccaccatgatctac
tacgctgagcgcattggggccaggccctccgaccctcggggtaatgaccacaccgacttc
aagaacatccccattggcttctggtgggctgtggtcaccatgacgacactgggctacgga
gacatgtaccccaagacgtggtcaggcatgctggtaggggcactgtgtgcactggctggc
gtgctcaccatcgccatgccggtgcctgtcatcgtcaacaacttcggcatgtactactcc
ctggccatggccaagcagaagctgcccaagaaacggaagaagcacgtgccacggccggcg
cagctggagtcacccatgtactgcaagtctgaggagacttccccccgggacagcacctgc
agtgataccagcccccctgcccgggaagagggtatgatcgagaggaaacgggcagactct
aagcagaatggcgatgccaacgcagtgctgtctgatgaggagggagctggcctcacccaa
cccctggcctcctccccgacccccgaggagcgccgggccctgcgacgctccaccactcga
gacagaaacaagaaggcagctgcctgcttcctgctcagcactggggactatgcctgcgcc
gatggtagtgtccggaaaggcacattcgtcctccgtgaccttccccttcagcattcacct
gaggctgcatgccctccaactgctgggactctgttcctgccacattga

DBGET integrated database retrieval system