KEGG   Homo sapiens (human): 374969
Entry
374969            CDS       T01001                                 
Symbol
SVBP, CCDC23, NEDAHM
Name
(RefSeq) small vasohibin binding protein
  KO
K23357  small vasohibin-binding protein
Organism
hsa  Homo sapiens (human)
Disease
H02461  Neurodevelopmental disorder with microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    374969 (SVBP)
SSDB
Motif
Pfam: CCDC23 DUF6851 Lipoprotein_18
Other DBs
NCBI-GeneID: 374969
NCBI-ProteinID: NP_955374
OMIM: 617853
HGNC: 29204
Ensembl: ENSG00000177868
UniProt: Q8N300
Position
1:complement(42807052..42817397)
AA seq 66 aa
MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQ
MQPPGE
NT seq 201 nt   +upstreamnt  +downstreamnt
atggatccacctgcacgtaaagaaaaaaccaaagttaaagaatctgtcagcagagttgag
aaggccaaacagaaatcagcccagcaggagctgaagcagagacaaagagcagagatctat
gccctcaacagagtcatgacagaactggagcagcagcagtttgatgagttctgtaaacag
atgcagcctcctggagaatga

DBGET integrated database retrieval system