KEGG   Homo sapiens (human): 3750
Entry
3750              CDS       T01001                                 

Gene name
KCND1, KV4.1
Definition
(RefSeq) potassium voltage-gated channel subfamily D member 1
  KO
K04891  potassium voltage-gated channel Shal-related subfamily D member 1
Organism
hsa  Homo sapiens (human)
Network
nt06411  Potassium transport
nt06462  Spinocerebellar ataxia
  Element
N00974  Transport of potassium
Drug target
Amifampridine: D10228<US> D10689<US>
Butamben (DG02875): D00730
Clofilium phosphate: D03547
Fampridine: D04127<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3750 (KCND1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3750 (KCND1)
SSDB
Motif
Pfam: Ion_trans DUF3399 BTB_2 Ion_trans_2 Shal-type BTB_3 PKD_channel
Other DBs
NCBI-GeneID: 3750
NCBI-ProteinID: NP_004970
OMIM: 300281
HGNC: 6237
Ensembl: ENSG00000102057
Vega: OTTHUMG00000024127
Pharos: Q9NSA2(Tclin)
UniProt: Q9NSA2
Position
Xp11.23
AA seq 647 aa
MAAGLATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGSARRSSREQPCGERFPQAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLLVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRR
AIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggcggcaggcctggccacgtggctgccttttgctcgggcagcagcagtgggctggctg
cccctggcccagcaacccctgcccccggcaccgggggtgaaggcatctcgaggagatgag
gttctggtggtgaacgtgagcggacggcgctttgagacttggaagaatacgctggaccgc
tacccagacaccttgctgggcagctcggagaaggaattcttctacgatgctgactcaggc
gagtacttcttcgatcgcgaccctgacatgttccgccatgtgctgaacttctaccgaacg
gggcggctgcattgcccacggcaggagtgcatccaggccttcgacgaagagctggctttc
tacggcctggttcccgagctagtcggtgactgctgccttgaagagtatcgggaccgaaag
aaggagaatgccgagcgcctggcagaggatgaggaggcagagcaggccggggacggccca
gccctgccagcaggcagctccctgcggcagcggctctggcgggccttcgagaatccacac
acgagcaccgcagccctcgttttctactatgtgaccggcttcttcatcgccgtgtcggtc
atcgccaatgtggtggagaccatcccatgccgcggctctgcacgcaggtcctcaagggag
cagccctgtggcgaacgcttcccacaggcctttttctgcatggacacagcctgtgtactc
atattcacaggtgaatacctcctgcggctgtttgccgcccccagccgttgccgcttcctg
cggagtgtcatgagcctcatcgacgtggtggccatcctgccctactacattgggcttttg
gtgcccaagaacgacgatgtctctggcgcctttgtcaccctgcgtgtgttccgggtgttt
cgcatcttcaagttctccaggcactcacagggcttgaggattctgggctacacactcaag
agctgtgcctctgagctgggctttctcctcttttccctaaccatggccatcatcatcttt
gccactgtcatgttttatgctgagaagggcacaaacaagaccaactttacaagcatccct
gcggccttctggtataccattgtcaccatgaccacgcttggctacggagacatggtgccc
agcaccattgctggcaagattttcgggtccatctgctcactcagtggcgtcttggtcatt
gccctgcctgtgccagtcattgtgtccaactttagccgcatctaccaccagaaccagcgg
gctgacaagcgccgagcacagcagaaggtgcgcttggcaaggatccgattggcaaagagt
ggtaccaccaatgccttcctgcagtacaagcagaatgggggccttgaggacagcggcagt
ggcgaggaacaggctctttgtgtcaggaaccgttctgcctttgaacagcaacatcaccac
ttgctgcactgtctagagaagacaacgtgccatgagttcacagatgagctcaccttcagt
gaagccctgggagccgtctcgccgggtggccgcaccagccgtagcacctctgtgtcttcc
cagccagtgggacccggaagcctgctgtcttcttgctgccctcgcagggccaagcgccgc
gccatccgccttgccaactccactgcctcagtcagccgtggcagcatgcaggagctggac
atgctggcagggctgcgcaggagccatgcccctcagagccgttccagcctcaatgccaag
ccccatgacagccttgacctgaactgcgacagccgggacttcgtggctgccattatcagc
atccctacccctcctgccaacaccccagatgagagccaaccttcctcccctggcggcggt
ggcagggccggcagcaccctcaggaactccagcctgggtaccccttgcctcttccccgag
actgtcaagatctcatccctgtga

DBGET integrated database retrieval system