KEGG   Homo sapiens (human): 375035Help
Entry
375035            CDS       T01001                                 

Gene name
SFT2D2, UNQ512, dJ747L4.C1.2
Definition
(RefSeq) SFT2 domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Got1 PTPS_related DUF4064 DUF5423 PGG DUF2244 Bac_export_2
Motif
Other DBs
NCBI-GeneID: 375035
NCBI-ProteinID: NP_955376
HGNC: 25140
Ensembl: ENSG00000213064
Vega: OTTHUMG00000034650
Pharos: O95562(Tdark)
UniProt: O95562
Position
1q24.2
AA seq 160 aa AA seqDB search
MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRK
GLHLFAVFYTFGNIASIGSTIFLMGPVKQLKRMFEPTRLIATIMVLLCFALTLCSAFWWH
NKGLALIFCILQSLALTWYSLSFIPFARDAVKKCFAVCLA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggacaagctgaagaaggtgctgagcgggcaggacacggaggaccggagcggcctgtcc
gaggttgttgaggcatcttcattaagctggagtaccaggataaaaggcttcattgcgtgt
tttgctataggaattctctgctcactgctgggtactgttctgctgtgggtgcccaggaag
ggactacacctcttcgcagtgttttatacctttggtaatatcgcatcaattgggagtacc
atcttcctcatgggaccagtgaaacagctgaagcgaatgtttgagcctactcgtttgatt
gcaactatcatggtgctgttgtgttttgcacttaccctgtgttctgccttttggtggcat
aacaagggacttgcacttatcttctgcattttgcagtctttggcattgacgtggtacagc
ctttccttcataccatttgcaagggatgctgtgaagaagtgttttgccgtgtgtcttgca
taa

DBGET integrated database retrieval system