KEGG   Homo sapiens (human): 3751Help
Entry
3751              CDS       T01001                                 

Gene name
KCND2, KV4.2, RK5
Definition
(RefSeq) potassium voltage-gated channel subfamily D member 2
  KO
K04892  potassium voltage-gated channel Shal-related subfamily D member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
Drug target
Amifampridine: D10228 D10689
Butamben (DG02875): D00730
Clofilium phosphate: D03547
Fampridine: D04127
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3751 (KCND2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3751 (KCND2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3751 (KCND2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans DUF3399 BTB_2 Ion_trans_2 Shal-type BTB_3 PKD_channel
Motif
Other DBs
NCBI-GeneID: 3751
NCBI-ProteinID: NP_036413
OMIM: 605410
HGNC: 6238
Ensembl: ENSG00000184408
Vega: OTTHUMG00000156989
Pharos: Q9NZV8(Tclin)
UniProt: Q9NZV8 A4D0V9
Position
7q31.31
AA seq 630 aa AA seqDB search
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE
RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA
FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF
TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA
FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHH
LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI
PNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI
PTPPVTTPEGDDRPESPEYSGGNIVRVSAL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgggggtggcagcgtggctgccttttgcaagggcagcggctatcgggtggatg
cctgtggcctcggggcctatgccggctcccccgaggcaggagaggaaaaggacccaagat
gctctcattgtgctgaatgtgagtggcacccgcttccagacgtggcaggacaccctggaa
cgttacccagacactctactgggcagttctgagagggactttttctaccacccagaaact
cagcagtatttctttgaccgtgacccagacatcttccgccacatcctgaatttctaccgc
actgggaagctccactatcctcgccacgagtgcatctctgcttacgatgaagaactggcc
ttctttggcctcatcccggaaatcatcggcgactgctgttatgaggagtacaaggatcgc
aggcgagagaacgccgagcgcctgcaggacgacgcggataccgacaccgctggggagagc
gccttgcccaccatgactgcaaggcagagggtctggagggccttcgagaacccccacacc
agcacgatggccctggtgttctactatgtcacggggtttttcattgccgtctctgtcatc
gcgaatgtggtggaaacagtgccgtgcggatcaagcccaggtcacattaaagaactgccc
tgtggagagcggtatgctgtggccttcttctgcttggacacggcctgcgtcatgatcttc
acagttgagtatttgcttcgcctggctgcagcgcctagtcgttaccgttttgtgcgtagt
gtcatgagtatcatcgacgtggtggccatcctgccttattacattgggctggtgatgaca
gacaatgaggacgtcagcggagcctttgtcacactccgagtcttccgggtcttcaggatc
tttaagttttcccgccactctcaaggcctgcgcatcctggggtacacactgaagagttgt
gcctcagaattgggcttcttgcttttctcgctcaccatggctatcatcatcttcgctaca
gttatgttctacgcagagaaggggtcttcggctagcaagttcaccagcatccctgcagcc
ttctggtataccatcgtcaccatgacaacactagggtatggtgacatggtgccaaaaacc
atagcagggaagatttttggttctatctgttcgctgagtggggtcttggtcattgctcta
cctgttccggtgattgtatccaacttcagtcgcatctaccaccagaatcaacgagcagac
aaacgaagggcacaaaagaaagctagactggccaggatccgggcagccaaaagcggaagc
gcaaatgcttacatgcagagcaaacggaatggtttactcagtaatcagctgcagtcctca
gaggatgagcaggcttttgttagcaaatccggctccagctttgaaacccagcaccaccac
ctgcttcactgcctggaaaaaaccacgaatcacgagtttgtggacgaacaagtctttgaa
gaaagctgcatggaagttgcaactgttaatcgtccttcaagtcacagtccttcactgtct
tcacaacaaggagtcaccagcacctgctgttcacgacgacacaaaaaaacttttcgcatc
ccaaatgccaatgtatcaggaagccatcaaggtagtatacaagaactcagcacgattcag
atcagatgtgtggagagaacacctctgtctaacagccgatccagtttaaatgccaaaatg
gaagagtgtgttaaactaaactgtgaacaaccttatgtgactacagcaataataagcatc
ccaacacctccagtaaccacaccagaaggagacgataggccagaatcccctgagtactca
ggaggaaatattgtcagagtttctgctttgtaa

DBGET integrated database retrieval system