KEGG   Homo sapiens (human): 375318Help
Entry
375318            CDS       T01001                                 

Gene name
AQP12A, AQP-12, AQP12, AQPX2
Definition
(RefSeq) aquaporin 12A
  KO
K09871  aquaporin-12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    375318 (AQP12A)
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    375318 (AQP12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 375318
NCBI-ProteinID: NP_945349
OMIM: 609789
HGNC: 19941
Ensembl: ENSG00000184945
Vega: OTTHUMG00000183906
Pharos: Q8IXF9(Tbio)
UniProt: Q8IXF9
Position
2q37.3
AA seq 295 aa AA seqDB search
MAGLNVSLSFFFATFALCEAARRASKALLPVGAYEVFAREAMRTLVELGPWAGDFGPDLL
LTLLFLLFLAHGVTLDGASANPTVSLQEFLMAEQSLPGTLLKLAAQGLGMQAACTLMRLC
WAWELSDLHLLQSLMAQSCSSALRTSVPHGALVEAACAFCFHLTLLHLRHSPPAYSGPAV
ALLVTVTAYTAGPFTSAFFNPALAASVTFACSGHTLLEYVQVYWLGPLTGMVLAVLLHQG
RLPHLFQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVEGPHSS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtcttaacgtgtccctctccttcttctttgccaccttcgccctctgtgaggcg
gccaggcgggcctccaaggccctgctcccagtgggcgcctatgaagtcttcgcccgggag
gcgatgaggacgctggtcgagctcgggccctgggctggggactttgggcctgacctgctg
ctcaccctgctcttcctgctcttcctggcgcacggggtcaccttggacggggcctcggcc
aaccccactgtgtccctgcaggagttcctcatggccgagcagtctctgcctggcacgctg
ttgaagctggcggcacaggggctgggcatgcaggccgcctgcaccctgatgcgcctctgc
tgggcctgggagctcagtgacctgcacctgctgcagagcctcatggcccagagctgcagc
tcggccctgcgcacatccgtgccccacggggcgcttgtggaggccgcctgcgccttttgt
ttccatctgaccctcctgcacctgcggcacagtcctcccgcctacagcgggcccgctgtg
gctctgttggtcaccgtcacggcctacacggccgggcccttcacgtctgccttcttcaac
cctgccctggccgcctctgtgacctttgcctgctcgggacacaccttactggagtacgtg
caggtgtactggctgggccctctgacagggatggtcctggctgtgctgctgcaccagggc
cgccttccccaccttttccagaggaacctgttctacggccagaagaacaagtaccgagca
ccccgagggaagccggccccggcctcaggggacacccagacccctgcaaaggggtccagt
gtccgggagcctgggcgcagtggtgttgaggggccacattccagctga

DBGET integrated database retrieval system