KEGG   Homo sapiens (human): 375341
Entry
375341            CDS       T01001                                 
Symbol
C3orf62, MAPS
Name
(RefSeq) chromosome 3 open reading frame 62
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4712
Other DBs
NCBI-GeneID: 375341
NCBI-ProteinID: NP_940964
HGNC: 24771
Ensembl: ENSG00000188315
Pharos: Q6ZUJ4(Tdark)
UniProt: Q6ZUJ4
Position
3:complement(49268596..49277232)
AA seq 267 aa
MHYIKTWSLLGEMSEKLRRCRKELTAAIDRAFEGVSYSQECTGQQRLELSAAPLSFSLPV
HRLLCRRHPLAACSSAAPFAAVPCAPENENPAFATNHAPVNAKPHALCPERKPLTSKENV
LMHSSILAPERESWRTAGEGENWRKENLRKDMERDLKADSNMPLNNSSQEVTKDLLDMID
HTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKATDADPGSLKQAF
DDHNIVETVLDLEEDYNVMTSFKYQIE
NT seq 804 nt   +upstreamnt  +downstreamnt
atgcattacataaagacatggtcgcttttaggagaaatgtctgaaaaactaagaagatgc
agaaaggaactgactgcagccattgaccgggcctttgaaggagttagttattcccaggag
tgcacaggccagcagaggctggaactgagcgccgcgccgctctccttctcgctgcccgtg
cacaggctcctctgcagaagacatcctctggcagcctgctcttctgctgctccttttgct
gctgtcccatgtgctcctgagaatgagaaccctgcctttgcaacaaaccatgccccggta
aatgcaaaaccacatgctctgtgccccgagagaaaacctctaaccagcaaggaaaatgta
ttgatgcattcctccattttggcacctgaaagagagtcttggagaactgcaggagagggg
gaaaactggagaaaagaaaatttaaggaaagatatggagagagatttgaaggctgactca
aacatgccactcaacaattctagccaagaggtcacaaaggatctgcttgatatgattgac
catacaagcatccgaactattgaagaattggctggaaaaatagaatttgaaaacgaattg
aaccacatgtgtggtcattgccaagattcacccttcaaagaggaagcctgggccctgctc
atggacaagagccctcagaaggccacagatgctgaccctggcagcctcaaacaggctttt
gatgatcataatattgttgagactgttctggacttggaagaggactacaatgtgatgacg
tcttttaaataccaaattgagtaa

DBGET integrated database retrieval system