KEGG   Homo sapiens (human): 3755
Entry
3755              CDS       T01001                                 

Gene name
KCNG1, K13, KCNG, KV6.1, kH2
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily G member 1
  KO
K04900  potassium voltage-gated channel subfamily G member 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3755 (KCNG1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3755 (KCNG1)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2
Other DBs
NCBI-GeneID: 3755
NCBI-ProteinID: NP_002228
OMIM: 603788
HGNC: 6248
Ensembl: ENSG00000026559
Vega: OTTHUMG00000032745
Pharos: Q9UIX4(Tclin)
UniProt: Q9UIX4 Q86Y85
Position
20q13.13
AA seq 513 aa
MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPED
RRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMV
EREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
AVNLSVSTLPSLREEEEQGHCSQMCHNVFIVESVCVGWFSLEFLLRLIQAPSKFAFLRSP
LTLIDLVAILPYYITLLVDGAAAGRRKPGAGNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFR
RAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaccctcttaccgggagacaattctgactacgactacagcgcgctgagctgcacctcg
gacgcctccttccacccggccttcctcccgcagcgccaggccatcaagggcgcgttctac
cgccgggcgcagcggctgcggccgcaggatgagccccgccagggctgtcagcccgaggac
cgccgccgtcggatcatcatcaacgtaggcggcatcaagtactcgctgccctggaccacg
ctggacgagttcccgctgacgcgcctgggccagctcaaggcctgcaccaacttcgacgac
atcctcaacgtgtgcgatgactacgacgtcacctgcaacgagttcttcttcgaccgcaac
ccgggggccttcggcactatcctgaccttcctgcgcgcgggcaagctgcggctgctgcgc
gagatgtgcgcgctgtccttccaggaggagctgctgtactggggcatcgcggaggaccac
ctggacggctgctgcaagcgccgctacctgcagaagattgaggagttcgcggagatggtg
gagcgggaggaagaggacgacgcgctggacagcgagggccgcgacagcgagggcccggcc
gagggcgagggccgcctggggcgctgcatgcggcgactgcgcgacatggtggagaggccg
cactcggggctgcctggcaaggtgttcgcctgcctgtcggtgctcttcgtgaccgtcacc
gccgtcaacctctccgtcagcaccttgcccagcctgagggaggaggaggagcagggccac
tgttcccagatgtgccacaacgtcttcatcgtggagtcggtgtgcgtgggctggttctcc
ctggagttcctcctgcggctcattcaggcgcccagcaagttcgccttcctgcggagcccg
ctgacgctgatcgacctggtggccatcctgccctactacatcacgctgctggtggacggc
gccgccgcaggccgtcgcaagcccggcgcgggcaacagctacctggacaaggtggggctg
gtgctgcgcgtgctgcgggcgctgcgcatcctgtacgtgatgcgcctggcgcgccactcc
ctggggctgcagacgctggggctcacggcccgccgctgcacccgcgagttcgggctcctg
ctgctcttcctctgcgtggccatcgccctcttcgcgcccctgctctacgtcatcgagaac
gagatggccgacagccccgagttcaccagcatccctgcctgctactggtgggctgtcatc
accatgacgacggtgggctatggcgacatggtccccaggagcaccccgggccaggtagtg
gccctgagcagcatcctgagcggcatcctgctcatggccttcccagtcacctccatcttc
cacaccttctcccgctcctacctggagctcaagcaggagcaagagagggtgatgttccgg
agggcgcagttcctcatcaaaaccaagtcgcagctgagcgtgtcccaggacagtgacatc
ttgttcggaagtgcctcctcggacaccagagacaataactga

DBGET integrated database retrieval system