KEGG   Homo sapiens (human): 3756Help
Entry
3756              CDS       T01001                                 

Gene name
KCNH1, EAG, EAG1, Kv10.1, TMBTS, ZLS1, h-eag, hEAG1
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 1
  KO
K04904  potassium voltage-gated channel Eag-related subfamily H member 1
Organism
hsa  Homo sapiens (human)
Disease
H01573  Zimmermann-Laband syndrome
Drug target
Clofilium phosphate: D03547
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3756 (KCNH1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3756 (KCNH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS PAS_3 PAS_4 Cupin_2 Cupin_3 NPV_P10
Motif
Other DBs
NCBI-GeneID: 3756
NCBI-ProteinID: NP_758872
OMIM: 603305
HGNC: 6250
Ensembl: ENSG00000143473
Vega: OTTHUMG00000036309
Pharos: O95259(Tclin)
UniProt: O95259
Structure
PDB: 

Position
1q32.2
AA seq 989 aa AA seqDB search
MTMAGGRRGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEV
MQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQ
DKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHK
HSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVS
FKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDL
LSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLFSSLKVVRLLR
LGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLY
QLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFA
VAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYI
VSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTV
HCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCAN
VRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEER
MKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNVLTEHASANH
SLVKASVVTVRESPATPVSFQAASTSGVPDHAKLQAPGSECLGPKGGGGDCAKRKSWARF
KDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTDSCDSGITKSDLRLDNVGEARSP
QDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTS
RRSSQSPQELFEISRPQSPESERDIFGAS
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggctgggggcaggaggggactagtggcccctcaaaacacgtttctggagaat
attgttcggcggtccaatgatactaattttgtgttggggaatgctcagatagtggactgg
cctattgtgtacagcaatgatggattttgcaagctgtctggctatcacagggcagaagtg
atgcaaaaaagcagcacctgcagttttatgtatggggagctgactgataaagacacgatt
gaaaaagtgcggcaaacatttgagaactatgagatgaattcctttgaaattctgatgtac
aagaagaacaggacacctgtgtggttctttgtgaaaattgctccaattcgaaacgaacag
gataaagtggttttatttctttgcactttcagtgacataacagctttcaaacagccaatt
gaggatgattcatgtaaaggctgggggaagtttgctcggctgacaagagcactgacaagc
agcaggggtgtcctgcagcagctggctccaagcgtgcaaaaaggcgagaatgtccacaag
cactcccgcctggcagaggtcctacagctgggctcagacatccttccccagtacaagcaa
gaggcaccaaagactccccctcacatcatcttacattattgtgtttttaagaccacgtgg
gattggatcatcttgatcttgaccttctatacagccatcttggtcccttataatgtctcc
ttcaaaaccaggcagaataatgtggcctggctggttgttgatagcatcgtggatgttatc
tttttggtggacattgtgctcaattttcataccacctttgttggaccagcaggggaggtg
atttctgaccccaaacttatccgcatgaactacctgaagacgtggtttgtgattgacctt
ctgtcctgtttgccatatgatgtcatcaacgcttttgagaacgtggatgaggttagtgcc
tttatgggtgatccagggaagattggttttgctgatcagattccaccaccactggagggg
agagagagtcagggcatcagcagcctgttcagctctctaaaagttgtccggctgctccgt
cttgggcgagtggcccgtaagctggaccactacattgaatatggagctgctgtgctggtc
ctgctggtgtgtgtgtttgggctggctgcacactggatggcctgcatctggtacagcatt
ggggactatgagatctttgacgaggacaccaagacaatccgcaacaacagctggctgtac
caactagcgatggacattggcaccccttaccagtttaatgggtctggctcagggaagtgg
gaaggtggtcccagcaagaattctgtctacatctcctcgttgtatttcacaatgaccagc
ctcaccagtgtgggctttgggaacatcgccccatccacagacattgagaagatctttgca
gtggccatcatgatgattggctcacttctctatgccaccatcttcgggaatgtgacgact
attttccaacagatgtatgccaacaccaacagataccatgagatgctcaacagtgttcgg
gacttcctgaagctctaccaggtgccaaaaggattgagtgagcgagtaatggattatatt
gtgtccacttggtccatgtccagaggcattgacacagagaaggtcctgcagatctgcccc
aaggacatgagagccgacatctgcgtgcacctgaaccgcaaggtgttcaaggagcacccg
gccttccggctggccagtgatggctgcctccgggcactggccatggagttccagacggtg
cactgtgccccaggggacctcatctaccatgcaggagagagcgttgacagcctctgcttt
gtggtttctggctccctggaggtgatccaagatgatgaggtggtggccattctaggaaaa
ggagacgtgtttggagatgtgttctggaaggaagccacccttgcccagtcctgtgccaat
gttagggccttgacctactgtgatctgcatgtgatcaagcgggatgccctgcagaaagtg
ctggaattctacacggccttctcccattccttctcccggaacctgattctgacgtacaac
ttgaggaagaggattgtgttccggaagatcagcgatgtgaaacgtgaagaggaagaacgc
atgaaacgaaagaatgaggcccccctgatcttgcccccggaccaccctgtccggcgcctc
ttccagagattccgacagcagaaagaggccaggctggcagctgagagagggggccgggac
ctggatgacctagatgtggagaagggcaatgtccttacagagcatgcctccgccaaccac
agcctcgtgaaggccagcgtggtcaccgtgcgtgagagtcctgccacgcccgtatccttc
caggcagcctccacctccggggtgccagaccacgcaaagctacaggcgccagggtccgag
tgcctgggccccaaggggggcgggggcgattgtgccaagcgcaaaagctgggcccgcttc
aaagatgcttgcgggaagagtgaggactggaacaaggtgtccaaggctgagtcgatggag
acacttcccgagaggacaaaagcgtcaggcgaggccacactgaagaagacagactcgtgt
gacagtggcatcaccaagagcgacttgcgcctggacaacgtgggtgaggccaggagtccc
caggatcggagtcccatcctggcagaggtcaagcattcgttctaccccatccctgagcag
acgctgcaggccacagtcctggaggtgaggcacgagctgaaggaggacatcaaggcctta
aacgccaaaatgaccaatattgagaaacagctctctgagatactcaggatattaacttcc
agaagatcctctcagtctcctcaggagttgtttgaaatatcgaggccacagtccccagaa
tcagagagagacatttttggagccagctga

DBGET integrated database retrieval system