KEGG   Homo sapiens (human): 375686Help
Entry
375686            CDS       T01001                                 

Gene name
SPATC1, SPATA15
Definition
(RefSeq) spermatogenesis and centriole associated 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Speriolin_N Speriolin_C NEMO ZapB HALZ
Motif
Other DBs
NCBI-GeneID: 375686
NCBI-ProteinID: NP_940974
OMIM: 610874
HGNC: 30510
Ensembl: ENSG00000186583
Vega: OTTHUMG00000156976
Pharos: Q76KD6(Tdark)
UniProt: Q76KD6
Position
8q24.3
AA seq 591 aa AA seqDB search
MSLLTNYEGLRHQIERLVRENEELKKLVRLIRENHELKSAIKTQAGGLGISGFTSGLGEA
TAGLSSRQNNGVFLPPSPAVANERVLEEVGIMALAPLAEMLTSLQPSATPGSLMSPLTGT
LSTLLSGPAPTSQSSPLTSFLTSPIAGPLTGTLASSLGLPSTGTLTPSSLVAGPVAMSQS
SPLIAPVMGTVAVSLSSPLLSSTATPPGVSQNLLANPMSNLVLPEAPRLRLAEPLRGGPT
GPQSPACVVPTATTKVPLSTEPPQSTQDPEPLSMAFAGAPLQTSTPIGAMGTPAPKTAFS
FNTSDTQAQPSAAQEQVVPASVPTSPTTSPTVTVLASAPALAPQVATSYTPSSTTHIAQG
APHPPSRMHNSPTQNLPVPHCPPHNAHSPPRTSSSPASVNDSRGPRTTEPSTKSMMEVER
KLAHRKTSKFPENPRESKQLAWERLVGEIAFQLDRRILSSIFPERVRLYGFTVSNIPEKI
IQASLNPSDHKLDEKLCQRLTQRYVSVMNRLQSLGYNGRVHPALTEQLVNAYGILRERPE
LAASEGGPYTVDFLQRVVVETVHPGMLADALLLLSCLSQLAHDDGKPMFIW
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtctctactcaccaattatgaagggcttcggcatcagatagagaggctggtgcgggaa
aatgaggaactgaagaagttggtgcggctcattcgggagaatcacgagctcaagtcagcg
atcaagactcaggcaggcgggctcggcatcagcgggttcacgagtgggcttggtgaggca
acagcaggcctttcctcacgccagaacaatggtgtcttcctgcccccgtccccagcagtg
gcaaacgaacgagtcctcgaagaagtggggatcatggccttggcacccctggccgagatg
ctaaccagcttgcagcccagcgccacaccgggctcactcatgagccccctgacaggcacc
ctcagcacgctgctgtctggcccagcacccacgtcacagagcagccccctcaccagcttc
ctgaccagtcccattgcgggacccctaacaggcacactggccagttccctgggcctgccc
tccactggcaccctgactcccagcagcctcgtggcaggccctgtggccatgtcccagagc
agccccctgatagcccctgtgatgggcacggtggctgtctctctgagcagccccctcctc
agctccactgccaccccaccaggggtctctcagaacctgctggccaaccccatgagcaac
ctggtcctgccagaggccccaaggctgcggctggctgagccactccgcggaggccccact
gggccccagtccccagcttgcgtggtacccactgccaccaccaaagtcccactctccact
gagcccccccagtcgacccaggacccagagcctctcagcatggcgtttgcaggagcaccc
ctccagacctccacccctatcggagccatgggcacacctgctcccaagacggccttctcc
ttcaacacttcggacacacaggcccagcccagtgccgcccaggaacaagtggtccctgca
tctgtccccacctcccccaccacctcccccacggtcaccgtccttgcctctgcccccgcc
cttgccccccaggttgccaccagctacacaccctcaagcaccacccacatcgcccagggt
gccccccatcccccttcccgaatgcataattccccaacccagaacctgcctgtcccccac
tgtcctccacacaacgcccactccccacctcgtacctcatcctccccggcttcagtcaat
gactctcgaggtccacgcaccacagaaccgtcgacgaagagcatgatggaggtggaacgg
aagctggcccaccgcaagaccagcaagttccccgagaacccccgagagtcgaagcagctg
gcctgggagaggctggtgggtgagattgccttccagctggaccgcaggatcctgtccagc
atcttcccagagcgcgtacggctctacggcttcactgtctccaacatcccagagaagatc
atccaggcttccctgaaccccagtgaccacaagctggatgagaagctgtgccagaggctc
acacagcgctatgtgagcgtcatgaacaggctgcagagtctgggctacaacgggcgggtg
caccctgcgctgaccgagcagctggtgaacgcttatggcatcctgcgagagcgcccggag
ctggcggcgtctgagggcggcccctacaccgtggacttcctgcagcgtgtggtggtggag
accgtgcaccccggcatgctcgccgacgcgctgctgctgctctcctgcctcagccagctg
gcgcacgatgacggcaagcccatgttcatctggtga

DBGET integrated database retrieval system