KEGG   Homo sapiens (human): 375743
Entry
375743            CDS       T01001                                 
Symbol
PTAR1
Name
(RefSeq) protein prenyltransferase alpha subunit repeat containing 1
  KO
K14137  protein prenyltransferase alpha subunit repeat containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hsa01006]
    375743 (PTAR1)
Prenyltransferases [BR:hsa01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   375743 (PTAR1)
SSDB
Motif
Pfam: PPTA
Other DBs
NCBI-GeneID: 375743
NCBI-ProteinID: NP_001093136
HGNC: 30449
Ensembl: ENSG00000188647
Vega: OTTHUMG00000019982
Pharos: Q7Z6K3(Tdark)
UniProt: Q7Z6K3
Structure
Position
9:complement(69709525..69760011)
AA seq 402 aa
MAETSEEVAVLVQRVVKDITNAFRRNPHIDEIGLIPCPEARYNRSPIVLVENKLGVESWC
VKFLLPYVHNKLLLYRTRKQWLNRDELIDVTCTLLLLNPDFTTAWNVRKELILSGTLNPI
KDLHLGKLALTKFPKSPETWIHRRWVLQQLIQETSLPSFVTKGNLGTIPTERAQRLIQEE
MEVCGEAAGRYPSNYNAWSHRIWVLQHLAKLDVKILLDELSSTKHWASMHVSDHSGFHYR
QFLLKSLISQTVIDSSVMEQNPLRSEPALVPPKDEEAAVSTEEPRINLPHLLEEEVEFST
DLIDSYPGHETLWCHRRHIFYLQHHLNAGSQLSQAMEVDGLNDSSKQGYSQETKRLKRTP
VPDSLGLEMEHRFIDQVLSTCRNVEQARFASAYRKWLVTLSQ
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggccgagaccagcgaggaggtggcggtgctggtgcagcgggttgtgaaggacatcact
aacgccttcaggaggaacccacacatagatgaaattggcctgatcccatgtcctgaagct
aggtataaccggagtcccatagtcctggttgaaaacaaactgggtgtggagagctggtgt
gtcaagttccttttaccatatgtccacaacaagctccttttgtacagaacaagaaagcaa
tggctgaacagagatgaattgatagatgtcacatgtaccctgctgcttctaaacccagac
tttaccactgcatggaacgtgaggaaagagctgatcctctctggcactttaaatccaatt
aaggatttacatctgggaaaactcgccttaaccaagtttccaaagagtccagaaacatgg
attcacaggcgatgggtgctacaacagctaattcaggaaacctccttgccttcctttgtg
accaaaggaaacttgggaacaattcccacagaaagggcacagcgactcatacaagaagag
atggaggtctgtggtgaagcagcagggagatacccaagcaactataatgcttggtcccat
cgcatctgggttttacagcacttggccaagctagatgtcaagattcttcttgatgaacta
tcttctactaaacattgggcatctatgcacgtttcagaccacagtggatttcactaccgc
cagtttttgcttaagtctttgattagccaaactgtgatagacagttctgtgatggagcaa
aatcctttgagaagtgagccagccctagttcctccaaaagatgaagaagcagcagtttca
acagaagaaccaaggattaatcttccccatcttctagaagaagaagttgaattcagcact
gatcttattgattcctacccaggacatgaaaccctttggtgtcataggcggcatattttc
taccttcagcatcacttaaatgcaggctcccagctgtctcaagcaatggaagtagatgga
ctgaatgactctagcaagcaaggctattcccaggaaaccaaacgcctgaagcggacgcca
gttccagactccctaggcctagaaatggagcacaggttcattgatcaagtattgtccacc
tgtcggaacgtggagcaagccaggtttgccagtgcatacaggaaatggctggttactttg
agtcaatga

DBGET integrated database retrieval system