KEGG   Homo sapiens (human): 3758
Entry
3758              CDS       T01001                                 

Gene name
KCNJ1, KIR1.1, ROMK, ROMK1
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 1
  KO
K04995  potassium inwardly-rectifying channel subfamily J member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04971  Gastric acid secretion
Disease
H00239  Bartter syndrome
Drug target
Betanidine: D01603
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    3758 (KCNJ1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3758 (KCNJ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3758 (KCNJ1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3758 (KCNJ1)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 3758
NCBI-ProteinID: NP_000211
OMIM: 600359
HGNC: 6255
Ensembl: ENSG00000151704
Vega: OTTHUMG00000048247
Pharos: P48048(Tchem)
UniProt: P48048 A8K432
Position
11q24.3
AA seq 391 aa
MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaatgcttccagtcggaatgtgtttgacacgttgatcagggtgttgacagaaagtatg
ttcaaacatcttcggaaatgggtcgtcactcgcttttttgggcattctcggcaaagagca
aggctagtctccaaagatggaaggtgcaacatagaatttggcaatgtggaggcacagtca
aggtttatattctttgtggacatctggacaacggtacttgacctcaagtggagatacaaa
atgaccattttcatcacagccttcttggggagttggtttttctttggtctcctgtggtat
gcagtagcgtacattcacaaagacctcccggaattccatccttctgccaatcacactccc
tgtgtggagaatattaatggcttgacctcagcttttctgttttctctggagactcaagtg
accattggatatggattcaggtgtgtgacagaacagtgtgccactgccatttttctgctt
atctttcagtctatacttggagttataatcaattctttcatgtgtggggccatcttagcc
aagatctccaggcccaaaaaacgtgccaagaccattacgttcagcaagaacgcagtgatc
agcaaacggggagggaagctttgcctcctaatccgagtggctaatctcaggaagagcctt
cttattggcagtcacatttatggaaagcttctgaagaccacagtcactcctgaaggagag
accattattttggaccagatcaatatcaactttgtagttgacgctgggaatgaaaattta
ttcttcatctccccattgacaatttaccatgtcattgatcacaacagccctttcttccac
atggcagcggagacccttctccagcaggactttgaattagtggtgtttttagatggcaca
gtggagtccaccagtgctacctgccaagtccggacatcctatgtcccagaggaggtgctt
tggggctaccgttttgctcccatagtatccaagacaaaggaagggaaataccgagtggat
ttccataactttagcaagacagtggaagtggagacccctcactgtgccatgtgcctttat
aatgagaaagatgttagagccaggatgaagagaggctatgacaaccccaacttcatcttg
tcagaagtcaatgaaacagatgacaccaaaatgtaa

DBGET integrated database retrieval system