KEGG   Homo sapiens (human): 3759Help
Entry
3759              CDS       T01001                                 

Gene name
KCNJ2, ATFB9, HHBIRK1, HHIRK1, IRK1, KIR2.1, LQT7, SQT3
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 2
  KO
K04996  potassium inwardly-rectifying channel subfamily J member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
hsa04924  Renin secretion
hsa04971  Gastric acid secretion
Disease
H00215  Periodic paralysis
H00720  Long QT syndrome
H00725  Short QT syndrome
H00731  Atrial fibrillation
H00748  Andersen-Tawil syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    3759 (KCNJ2)
   04924 Renin secretion
    3759 (KCNJ2)
  09154 Digestive system
   04971 Gastric acid secretion
    3759 (KCNJ2)
  09156 Nervous system
   04725 Cholinergic synapse
    3759 (KCNJ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3759 (KCNJ2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3759 (KCNJ2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 Ion_trans
Motif
Other DBs
NCBI-GeneID: 3759
NCBI-ProteinID: NP_000882
OMIM: 600681
HGNC: 6263
Ensembl: ENSG00000123700
Vega: OTTHUMG00000180351
Pharos: P63252(Tbio)
UniProt: P63252
Position
17q24.3
AA seq 427 aa AA seqDB search
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtgtgcgaaccaaccgctacagcatcgtctcttcagaagaagacggtatgaag
ttggccaccatggcagttgcaaatggctttgggaacgggaagagtaaagtccacacccga
caacagtgcaggagccgctttgtgaagaaagatggccactgtaatgttcagttcatcaat
gtgggtgagaaggggcaacggtacctcgcagacatcttcaccacgtgtgtggacattcgc
tggcggtggatgctggttatcttctgcctggctttcgtcctgtcatggctgttttttggc
tgtgtgttttggttgatagctctgctccatggggacctggatgcatccaaagagggcaaa
gcttgtgtgtccgaggtcaacagcttcacggctgccttcctcttctccattgagacccag
acaaccataggctatggtttcagatgtgtcacggatgaatgcccaattgctgttttcatg
gtggtgttccagtcaatcgtgggctgcatcatcgatgctttcatcattggcgcagtcatg
gccaagatggcaaagccaaagaagagaaacgagactcttgtcttcagtcacaatgccgtg
attgccatgagagacggcaagctgtgtttgatgtggcgagtgggcaatcttcggaaaagc
cacttggtggaagctcatgttcgagcacagctcctcaaatccagaattacttctgaaggg
gagtatatccctctggatcaaatagacatcaatgttgggtttgacagtggaatcgatcgt
atatttctggtgtccccaatcactatagtccatgaaatagatgaagacagtcctttatat
gatttgagtaaacaggacattgacaacgcagactttgaaatcgtggtcatactggaaggc
atggtggaagccactgccatgacgacacagtgccgtagctcttatctagcaaatgaaatc
ctgtggggccaccgctatgagcctgtgctctttgaagagaagcactactacaaagtggac
tattccaggttccacaaaacttacgaagtccccaacactcccctttgtagtgccagagac
ttagcagaaaagaaatatatcctctcaaatgcaaattcattttgctatgaaaatgaagtt
gccctcacaagcaaagaggaagacgacagtgaaaatggagttccagaaagcactagtacg
gacacgccccctgacatagaccttcacaaccaggcaagtgtacctctagagcccaggccc
ttacggcgagagtcggagatatga

DBGET integrated database retrieval system