KEGG   Homo sapiens (human): 3760Help
Entry
3760              CDS       T01001                                 

Gene name
KCNJ3, GIRK1, KGA, KIR3.1
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 3
  KO
K04997  potassium inwardly-rectifying channel subfamily J member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05032  Morphine addiction
Drug target
Amiodarone (DG00204): D00636 D02910
Bepridil (DG00333): D00631 D07520
Dronedarone (DG00207): D02537 D03914
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3760 (KCNJ3)
   04921 Oxytocin signaling pathway
    3760 (KCNJ3)
  09156 Nervous system
   04724 Glutamatergic synapse
    3760 (KCNJ3)
   04725 Cholinergic synapse
    3760 (KCNJ3)
   04728 Dopaminergic synapse
    3760 (KCNJ3)
   04726 Serotonergic synapse
    3760 (KCNJ3)
   04723 Retrograde endocannabinoid signaling
    3760 (KCNJ3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    3760 (KCNJ3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    3760 (KCNJ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3760 (KCNJ3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3760 (KCNJ3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK
Motif
Other DBs
NCBI-GeneID: 3760
NCBI-ProteinID: NP_002230
OMIM: 601534
HGNC: 6264
Ensembl: ENSG00000162989
Vega: OTTHUMG00000131937
Pharos: P48549(Tbio)
UniProt: P48549
Position
2q24.1
AA seq 501 aa AA seqDB search
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
AARMEGNLPAKLRKMNSDRFT
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcactccgaaggaaatttggggacgattatcaggtagtgaccacatcgtccagc
ggctcgggcttgcagccccaggggccaggccaggaccctcagcagcagcttgtgcccaag
aagaagcggcagcggttcgtggacaagaacggccggtgcaatgtacagcacggcaacctg
ggcagcgagacaagccgctacctctcggacctcttcaccacgctggtggacctcaagtgg
cgctggaacctcttcatcttcattctcacctacaccgtggcctggcttttcatggcgtcc
atgtggtgggtgatcgcctacactcggggcgacctgaacaaagcccacgtcggtaactac
acgccttgcgtggccaatgtctataacttcccttctgccttcctcttcttcatcgagacg
gaggccaccatcggctatggctaccgatacatcacagacaagtgccccgagggcatcatc
ctcttcctcttccagtccatcctgggctccatcgtggacgccttcctcatcggctgcatg
ttcatcaagatgtcccagcccaagaagcgcgccgagaccctcatgttcagcgagcacgcg
gtgatctccatgagggacggaaaactcacgcttatgttccgggtgggcaacctgcgcaac
agccacatggtctccgcgcagattcgctgcaagctgctcaaatctcggcagacacctgag
ggtgagttccttccccttgaccaacttgaactggatgtaggttttagtacaggggcagat
caactttttcttgtgtcccccctcacaatttgccacgtgatcgatgccaaaagccccttt
tatgacctatcccagcgaagcatgcaaactgaacagttcgagattgtcgtcatcctagaa
ggcattgtggaaacaactgggatgacttgtcaagctcgaacatcatatactgaagatgaa
gttctttggggtcatcgtttttttcctgtaatttccttagaagagggattctttaaagtt
gattactcccagttccatgcaacatttgaagtccccaccccaccttacagtgtgaaagag
caggaggaaatgcttctcatgtcgtcccctttaatagcaccagccataactaacagcaaa
gaaagacataattctgtggaatgcttagatggactagatgatattactacaaaactacca
tctaagctgcagaaaattactggaagagaagactttcccaaaaaactcttgaggatgagt
tctacaacttcagaaaaagcctacagcttgggagacttgcccatgaaacttcaacgaata
agttcagttccgggcaactcagaagaaaaactggtatctaaaaccaccaagatgttatct
gatcccatgagccagtctgtggctgatttgccaccaaagcttcaaaagatggctggagga
gcagctaggatggaagggaaccttccagccaaattaagaaaaatgaactctgatcgcttc
acataa

DBGET integrated database retrieval system