KEGG   Homo sapiens (human): 3760Help
Entry
3760              CDS       T01001                                 

Gene name
KCNJ3, GIRK1, KGA, KIR3.1
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 3
  KO
K04997  potassium inwardly-rectifying channel subfamily J member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04929  GnRH secretion
hsa05032  Morphine addiction
Drug target
Amiodarone (DG00204): D00636 D02910
Bepridil (DG00333): D00631 D07520
Dronedarone (DG00207): D02537 D03914
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    3760 (KCNJ3)
   04915 Estrogen signaling pathway
    3760 (KCNJ3)
   04921 Oxytocin signaling pathway
    3760 (KCNJ3)
  09156 Nervous system
   04724 Glutamatergic synapse
    3760 (KCNJ3)
   04725 Cholinergic synapse
    3760 (KCNJ3)
   04728 Dopaminergic synapse
    3760 (KCNJ3)
   04726 Serotonergic synapse
    3760 (KCNJ3)
   04723 Retrograde endocannabinoid signaling
    3760 (KCNJ3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    3760 (KCNJ3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    3760 (KCNJ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3760 (KCNJ3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3760 (KCNJ3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK
Motif
Other DBs
NCBI-GeneID: 3760
NCBI-ProteinID: NP_002230
OMIM: 601534
HGNC: 6264
Ensembl: ENSG00000162989
Vega: OTTHUMG00000131937
Pharos: P48549(Tbio)
UniProt: P48549
Position
2q24.1
AA seq 501 aa AA seqDB search
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
AARMEGNLPAKLRKMNSDRFT
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcactccgaaggaaatttggggacgattatcaggtagtgaccacatcgtccagc
ggctcgggcttgcagccccaggggccaggccaggaccctcagcagcagcttgtgcccaag
aagaagcggcagcggttcgtggacaagaacggccggtgcaatgtacagcacggcaacctg
ggcagcgagacaagccgctacctctcggacctcttcaccacgctggtggacctcaagtgg
cgctggaacctcttcatcttcattctcacctacaccgtggcctggcttttcatggcgtcc
atgtggtgggtgatcgcctacactcggggcgacctgaacaaagcccacgtcggtaactac
acgccttgcgtggccaatgtctataacttcccttctgccttcctcttcttcatcgagacg
gaggccaccatcggctatggctaccgatacatcacagacaagtgccccgagggcatcatc
ctcttcctcttccagtccatcctgggctccatcgtggacgccttcctcatcggctgcatg
ttcatcaagatgtcccagcccaagaagcgcgccgagaccctcatgttcagcgagcacgcg
gtgatctccatgagggacggaaaactcacgcttatgttccgggtgggcaacctgcgcaac
agccacatggtctccgcgcagattcgctgcaagctgctcaaatctcggcagacacctgag
ggtgagttccttccccttgaccaacttgaactggatgtaggttttagtacaggggcagat
caactttttcttgtgtcccccctcacaatttgccacgtgatcgatgccaaaagccccttt
tatgacctatcccagcgaagcatgcaaactgaacagttcgagattgtcgtcatcctagaa
ggcattgtggaaacaactgggatgacttgtcaagctcgaacatcatatactgaagatgaa
gttctttggggtcatcgtttttttcctgtaatttccttagaagagggattctttaaagtt
gattactcccagttccatgcaacatttgaagtccccaccccaccttacagtgtgaaagag
caggaggaaatgcttctcatgtcgtcccctttaatagcaccagccataactaacagcaaa
gaaagacataattctgtggaatgcttagatggactagatgatattactacaaaactacca
tctaagctgcagaaaattactggaagagaagactttcccaaaaaactcttgaggatgagt
tctacaacttcagaaaaagcctacagcttgggagacttgcccatgaaacttcaacgaata
agttcagttccgggcaactcagaagaaaaactggtatctaaaaccaccaagatgttatct
gatcccatgagccagtctgtggctgatttgccaccaaagcttcaaaagatggctggagga
gcagctaggatggaagggaaccttccagccaaattaagaaaaatgaactctgatcgcttc
acataa

KEGG   Homo sapiens (human): 3762Help
Entry
3762              CDS       T01001                                 

Gene name
KCNJ5, CIR, GIRK4, KATP1, KIR3.4, LQT13
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 5
  KO
K04999  potassium inwardly-rectifying channel subfamily J member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04929  GnRH secretion
hsa05032  Morphine addiction
Network
nt06316  Angiotensin-aldosterone signaling
  Element
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
Disease
H00720  Long QT syndrome
H01603  Primary aldosteronism
Drug target
Amiodarone (DG00204): D00636 D02910
Bepridil (DG00333): D00631 D07520
Dronedarone (DG00207): D02537 D03914
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    3762 (KCNJ5)
   04915 Estrogen signaling pathway
    3762 (KCNJ5)
   04921 Oxytocin signaling pathway
    3762 (KCNJ5)
   04925 Aldosterone synthesis and secretion
    3762 (KCNJ5)
  09156 Nervous system
   04728 Dopaminergic synapse
    3762 (KCNJ5)
   04726 Serotonergic synapse
    3762 (KCNJ5)
   04723 Retrograde endocannabinoid signaling
    3762 (KCNJ5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    3762 (KCNJ5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    3762 (KCNJ5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3762 (KCNJ5)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3762 (KCNJ5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 3762
NCBI-ProteinID: NP_000881
OMIM: 600734
HGNC: 6266
Ensembl: ENSG00000120457
Vega: OTTHUMG00000165795
Pharos: P48544(Tbio)
UniProt: P48544
Position
11q24.3
AA seq 419 aa AA seqDB search
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgattctaggaatgccatgaaccaggacatggagattggagtcactccctgg
gaccccaagaagattccaaaacaggcccgcgattatgtccccattgccacagaccgtacg
cgcctgctggccgagggcaagaagccacgccagcgctacatggagaagagtggcaagtgc
aacgtgcaccacggcaacgtccaggagacctaccggtacctgagtgacctcttcaccacc
ctggtggacctcaagtggcgcttcaacttgctcgtcttcaccatggtttacactgtcacc
tggctgttcttcggcttcatttggtggctcattgcttatatccggggtgacctggaccat
gttggcgaccaagagtggattccttgtgttgaaaacctcagtggcttcgtgtccgctttc
ctgttctccattgagaccgaaacaaccattgggtatggcttccgagtcatcacagagaag
tgtccagaggggattatactcctcttggtccaggccatcctgggctccatcgtcaatgcc
ttcatggtggggtgcatgtttgtcaagatcagccagcccaagaagagagcggagaccctc
atgttttccaacaacgcagtcatctccatgcgggacgagaagctgtgcctcatgttccgg
gtgggcgacctccgcaactcccacatcgtggaggcctccatccgggccaagctcatcaag
tcccggcagaccaaagagggggagttcatccccctgaaccagacagacatcaacgtgggc
tttgacacgggcgacgaccgcctcttccttgtgtctcctctgatcatctcccatgagatc
aaccagaagagccctttctgggagatgtctcaggctcagctgcatcaggaagagtttgaa
gttgtggtcattctagaagggatggtggaagccacaggcatgacctgccaagcccggagc
tcctacatggatacagaggtgctctggggccaccgattcacaccagtcctcaccttggaa
aagggcttctatgaggtggactacaacaccttccatgatacctatgagaccaacacaccc
agctgctgtgccaaggagctggcagaaatgaagagggaaggccggctcctccagtacctc
cccagccccccactgctggggggctgtgctgaggcagggctggatgcagaggctgagcag
aatgaagaagatgagcccaaggggctgggtgggtccagggaggccaggggctcggtgtga

KEGG   Homo sapiens (human): 3763Help
Entry
3763              CDS       T01001                                 

Gene name
KCNJ6, BIR1, GIRK-2, GIRK2, KATP-2, KATP2, KCNJ7, KIR3.2, KPLBS, hiGIRK2
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 6
  KO
K05000  potassium inwardly-rectifying channel subfamily J member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04929  GnRH secretion
hsa05032  Morphine addiction
Disease
H02236  Keppen-Lubinsky syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    3763 (KCNJ6)
   04915 Estrogen signaling pathway
    3763 (KCNJ6)
   04921 Oxytocin signaling pathway
    3763 (KCNJ6)
  09156 Nervous system
   04727 GABAergic synapse
    3763 (KCNJ6)
   04725 Cholinergic synapse
    3763 (KCNJ6)
   04728 Dopaminergic synapse
    3763 (KCNJ6)
   04726 Serotonergic synapse
    3763 (KCNJ6)
   04723 Retrograde endocannabinoid signaling
    3763 (KCNJ6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    3763 (KCNJ6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    3763 (KCNJ6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3763 (KCNJ6)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3763 (KCNJ6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 3763
NCBI-ProteinID: NP_002231
OMIM: 600877
HGNC: 6267
Ensembl: ENSG00000157542
Vega: OTTHUMG00000086667
Pharos: P48051(Tchem)
UniProt: P48051
Position
21q22.13
AA seq 423 aa AA seqDB search
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE
SKV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgacagaatccatgactaacgtcctggagggcgactccatggatcaggac
gtcgaaagcccagtggccattcaccagccaaagttgcctaagcaggccagggatgacctg
ccaagacacatcagccgagatcggaccaaaaggaaaatccagaggtacgtgaggaaagac
ggaaagtgcaatgttcatcacggcaacgtgagggagacctatcgctacctgaccgatatc
ttcaccacattagtggacctgaagtggagattcaacctattgatttttgtcatggtttac
acagtgacctggctcttttttggaatgatctggtggttgatcgcatacatacggggagac
atggaccacatagaggacccctcctggactccttgtgttaccaacctcaacgggttcgtc
tctgcttttttattctcaatagagacagaaaccaccattggttatggctaccgggtcatc
acagataaatgcccagagggaattattcttctcttaatccaatctgtgttggggtccatt
gtcaatgcattcatggtgggatgcatgtttgtaaaaatctctcaacccaagaagagggca
gagaccctggtcttttccacccatgcagtgatctccatgcgggatgggaaactgtgcctg
atgttccgggtaggggaccttaggaattcccacattgtggaggcttccatcagagccaag
ttgatcaaatccaaacagacctcggagggggagttcatcccgttgaaccagacggatatc
aacgtagggtattacacgggggatgaccgtctgtttctggtgtcaccgctgatcattagc
catgaaattaaccaacagagtcctttctgggagatctccaaagcccagctgcccaaagag
gaactggaaattgtggtcatcctagaaggaatggtggaagccacagggatgacatgccaa
gctcgaagctcctacatcaccagtgagatcctgtggggttaccggttcacacctgtcctg
accctggaggacgggttctacgaagttgactacaacagcttccatgagacctatgagacc
agcaccccatcccttagtgccaaagagctggccgagttagccagcagggcagagctgccc
ctgagttggtctgtatccagcaaactcaaccaacatgcagaactggagactgaagaggaa
gaaaagaacctcgaagagcaaacagaaagaaatggtgatgtggcaaacctggagaatgaa
tccaaagtttag

KEGG   Homo sapiens (human): 3765Help
Entry
3765              CDS       T01001                                 

Gene name
KCNJ9, GIRK3, KIR3.3
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 9
  KO
K05002  potassium inwardly-rectifying channel subfamily J member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04929  GnRH secretion
hsa05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    3765 (KCNJ9)
   04915 Estrogen signaling pathway
    3765 (KCNJ9)
   04921 Oxytocin signaling pathway
    3765 (KCNJ9)
  09156 Nervous system
   04728 Dopaminergic synapse
    3765 (KCNJ9)
   04726 Serotonergic synapse
    3765 (KCNJ9)
   04723 Retrograde endocannabinoid signaling
    3765 (KCNJ9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    3765 (KCNJ9)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    3765 (KCNJ9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3765 (KCNJ9)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3765 (KCNJ9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 3765
NCBI-ProteinID: NP_004974
OMIM: 600932
HGNC: 6270
Ensembl: ENSG00000162728
Vega: OTTHUMG00000024072
Pharos: Q92806(Tbio)
UniProt: Q92806
Position
1q23.2
AA seq 393 aa AA seqDB search
MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggagaacgcggccttctcgcccgggcaggaggagccgccgcggcgccgcggc
cgccagcgctacgtggagaaggatggccggtgcaacgtgcagcagggcaacgtgcgcgag
acataccgctacctgacggacctgttcaccacgctggtggacctgcagtggcgcctcagc
ctgttgttcttcgtcctggcctacgcgctcacctggctcttcttcggcgccatctggtgg
ctgatcgcctacggccgcggcgacctggagcacctggaggacaccgcgtggacgccgtgc
gtcaacaacctcaacggcttcgtggccgccttcctcttctccatcgagaccgagaccacc
atcggctacgggcaccgcgtcatcaccgaccagtgccccgagggcatcgtgctgctgctg
ctgcaggccatcctgggctccatggtgaacgccttcatggtgggctgcatgttcgtcaag
atctcgcagcccaacaagcgcgcagccacgctcgtcttctcctcgcacgccgtggtgtcg
ctgcgcgacgggcgcctctgcctcatgttccgcgtgggcgacttgcgctcctcacacata
gtggaggcctccatccgcgccaagctcatccgctcgcgccagacgctggagggcgagttc
atcccgctgcaccagaccgacctcagcgtgggcttcgacacgggagacgaccgcctcttc
ctcgtctcgccgctggttatcagccacgagatcgacgccgccagccccttctgggaggcg
tcgcgccgtgccctcgagagggacgacttcgagatcgtcgttatcctcgagggcatggtg
gaagccacgggaatgacatgccaagctcggagctcctacctggtagacgaggtgctgtgg
ggccaccgcttcacgtcagtgctgactctggaggacggcttctacgaagtggactatgcc
agctttcacgagacttttgaggtgcccacaccttcgtgcagtgctcgagagctggcagag
gctgccgcccgccttgatgcccatctctactggtccatccccagccggctggatgagaag
gtggaggaggagggggcgggggagggggcgggtggggaagctggggctgacaaggagcag
aatggctgcctgccacccccagagagtgagtccaaggtgtga

DBGET integrated database retrieval system