KEGG   Homo sapiens (human): 3761Help
Entry
3761              CDS       T01001                                 

Gene name
KCNJ4, HIR, HIRK2, HRK1, IRK-3, IRK3, Kir2.3
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 4
  KO
K04998  potassium inwardly-rectifying channel subfamily J member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    3761 (KCNJ4)
  09156 Nervous system
   04725 Cholinergic synapse
    3761 (KCNJ4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3761 (KCNJ4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3761 (KCNJ4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 3761
NCBI-ProteinID: NP_004972
OMIM: 600504
HGNC: 6265
Ensembl: ENSG00000168135
Vega: OTTHUMG00000151131
Pharos: P48050(Tchem)
UniProt: P48050 A0A024R1L8
Position
22q13.1
AA seq 445 aa AA seqDB search
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNG
FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKK
RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR
DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT
TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV
LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG
SHLDLERMQASLPLDNISYRRESAI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcacggacacagccgcaacggccaggcccacgtgccccggcggaagcgccgcaaccgc
ttcgtcaagaagaacggccaatgcaacgtgtacttcgccaacctgagcaacaagtcgcag
cgctacatggcggacatcttcaccacctgcgtggacacgcgctggcgctacatgctcatg
atcttctccgcggccttccttgtctcctggctctttttcggcctcctcttctggtgtatc
gccttcttccacggtgacctggaggccagcccaggggtgcctgcggcggggggcccggcg
gcgggtggtggcggagcagccccggtggcccccaagccctgcatcatgcacgtgaacggc
ttcctgggtgccttcctgttctcggtggagacgcagacgaccatcggctatgggttccgg
tgcgtgacagaggagtgcccgctggcagtcatcgctgtggtggtccagtccatcgtgggc
tgcgtcatcgactccttcatgattggcaccatcatggccaagatggcgcggcccaagaag
cgggcgcagacgttgctgttcagccaccacgcggtcatttcggtgcgcgacggcaagctc
tgcctcatgtggcgcgtgggcaacctgcgcaagagccacattgtggaggcccacgtgcgg
gcccagctcatcaagccctacatgacccaggagggcgagtacctgcccctggaccagcgg
gacctcaacgtgggctatgacatcggcctggaccgcatcttcctggtgtcgcccatcatc
attgtccacgagatcgacgaggacagcccgctttatggcatgggcaaggaggagctggag
tcggaggactttgagatcgtggtcatcctggagggcatggtggaggccacggccatgacc
acccaggcccgcagctcctacctggccagcgagatcctgtggggccaccgctttgagcct
gtggtcttcgaggagaagagccactacaaggtggactactcacgttttcacaagacctac
gaggtggccggcacgccctgctgctcggcccgggagctgcaggagagtaagatcaccgtg
ctgcccgccccaccgccccctcccagtgccttctgctacgagaacgagctggcccttatg
agccaggaggaagaggagatggaggaggaggcagctgcggcggccgcggtggccgcaggc
ctgggcctggaggcgggttccaaggaggaggcgggcatcatccggatgctggagttcggc
agccacctggacctggagcgcatgcaggcttccctcccgctggacaacatctcctaccgc
agggagtctgccatctga

DBGET integrated database retrieval system