KEGG   Homo sapiens (human): 3763Help
Entry
3763              CDS       T01001                                 

Gene name
KCNJ6, BIR1, GIRK-2, GIRK2, KATP-2, KATP2, KCNJ7, KIR3.2, KPLBS, hiGIRK2
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 6
  KO
K05000  potassium inwardly-rectifying channel subfamily J member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3763 (KCNJ6)
   04921 Oxytocin signaling pathway
    3763 (KCNJ6)
  09156 Nervous system
   04727 GABAergic synapse
    3763 (KCNJ6)
   04725 Cholinergic synapse
    3763 (KCNJ6)
   04728 Dopaminergic synapse
    3763 (KCNJ6)
   04726 Serotonergic synapse
    3763 (KCNJ6)
   04723 Retrograde endocannabinoid signaling
    3763 (KCNJ6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    3763 (KCNJ6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    3763 (KCNJ6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3763 (KCNJ6)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3763 (KCNJ6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 3763
NCBI-ProteinID: NP_002231
OMIM: 600877
HGNC: 6267
Ensembl: ENSG00000157542
Vega: OTTHUMG00000086667
Pharos: P48051(Tchem)
UniProt: P48051
Position
21q22.13
AA seq 423 aa AA seqDB search
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE
SKV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgacagaatccatgactaacgtcctggagggcgactccatggatcaggac
gtcgaaagcccagtggccattcaccagccaaagttgcctaagcaggccagggatgacctg
ccaagacacatcagccgagatcggaccaaaaggaaaatccagaggtacgtgaggaaagac
ggaaagtgcaatgttcatcacggcaacgtgagggagacctatcgctacctgaccgatatc
ttcaccacattagtggacctgaagtggagattcaacctattgatttttgtcatggtttac
acagtgacctggctcttttttggaatgatctggtggttgatcgcatacatacggggagac
atggaccacatagaggacccctcctggactccttgtgttaccaacctcaacgggttcgtc
tctgcttttttattctcaatagagacagaaaccaccattggttatggctaccgggtcatc
acagataaatgcccagagggaattattcttctcttaatccaatctgtgttggggtccatt
gtcaatgcattcatggtgggatgcatgtttgtaaaaatctctcaacccaagaagagggca
gagaccctggtcttttccacccatgcagtgatctccatgcgggatgggaaactgtgcctg
atgttccgggtaggggaccttaggaattcccacattgtggaggcttccatcagagccaag
ttgatcaaatccaaacagacctcggagggggagttcatcccgttgaaccagacggatatc
aacgtagggtattacacgggggatgaccgtctgtttctggtgtcaccgctgatcattagc
catgaaattaaccaacagagtcctttctgggagatctccaaagcccagctgcccaaagag
gaactggaaattgtggtcatcctagaaggaatggtggaagccacagggatgacatgccaa
gctcgaagctcctacatcaccagtgagatcctgtggggttaccggttcacacctgtcctg
accctggaggacgggttctacgaagttgactacaacagcttccatgagacctatgagacc
agcaccccatcccttagtgccaaagagctggccgagttagccagcagggcagagctgccc
ctgagttggtctgtatccagcaaactcaaccaacatgcagaactggagactgaagaggaa
gaaaagaacctcgaagagcaaacagaaagaaatggtgatgtggcaaacctggagaatgaa
tccaaagtttag

DBGET integrated database retrieval system