KEGG   Homo sapiens (human): 3764Help
Entry
3764              CDS       T01001                                 

Gene name
KCNJ8, KIR6.1, uKATP-1
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 8
  KO
K05001  potassium inwardly-rectifying channel subfamily J member 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
Drug target
Amiodarone (DG00204): D00636 D02910
Bepridil (DG00333): D00631 D07520
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    3764 (KCNJ8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3764 (KCNJ8)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3764 (KCNJ8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans EI24
Motif
Other DBs
NCBI-GeneID: 3764
NCBI-ProteinID: NP_004973
OMIM: 600935
HGNC: 6269
Ensembl: ENSG00000121361
Vega: OTTHUMG00000169093
Pharos: Q15842(Tbio)
UniProt: Q15842 A0A024RAV6
Position
12p12.1
AA seq 424 aa AA seqDB search
MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSGLESTVC
VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK
TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV
VPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVV
ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE
KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQN
TSES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgttggccagaaagagtatcatcccggaggagtatgtgctggcgcgcatcgccgcagag
aacctgcgcaagccgcgcatccgagaccgcctccccaaagcccgcttcatcgccaagagc
ggggcctgcaacctggcgcataagaacatccgtgagcaaggacgctttctacaggacatc
ttcaccaccttggtggacctgaaatggcgccacacgctggtcatctttaccatgtccttc
ctctgcagctggctgctcttcgctatcatgtggtggctggtggcctttgcccatggggac
atctatgcttacatggagaaaagtggaatggagaaaagtggtttggagtccactgtgtgt
gtgactaatgtcaggtctttcacttctgcttttctcttctccattgaagttcaagttacc
attgggtttggagggaggatgatgacagaggaatgccctttggccatcacggttttgatt
ctccagaatattgtgggtttgatcatcaatgcagtcatgttaggctgcattttcatgaaa
acagctcaggctcacagaagggcagaaactttgattttcagccgccatgctgtgattgcc
gtccgaaatggcaagctgtgcttcatgttccgagtgggtgacctgaggaaaagcatgatc
attagtgcctctgtgcgcatccaggtggtcaagaaaacaactacacctgaaggggaggtg
gttcctattcaccaactggacattcctgttgataacccaatcgagagcaataacattttt
ctggtggcccctttgatcatctgccacgtgattgacaagcgcagtcccctgtatgacatc
tcagcaactgacctggccaaccaagacttggaggtcatagttattctggaaggagtggtt
gaaactactggcatcaccacacaagcacgaacctcctacattgctgaggagatccaatgg
ggccaccgctttgtgtccattgtgactgaggaagaaggagtgtattctgtggattactcc
aaatttggcaacactgttaaagtagctgctccacggtgcagtgcccgagagctggatgag
aaaccttccatccttattcagaccctccaaaagagtgaactgtctcatcaaaattctctg
aggaagcgcaactccatgagaagaaacaattccatgaggaggaacaattctatccgaagg
aacaattcttccctcatggtaccaaaggtgcaatttatgactccagaaggaaatcaaaac
acatcggaatcatga

DBGET integrated database retrieval system