KEGG   Homo sapiens (human): 3769Help
Entry
3769              CDS       T01001                                 

Gene name
KCNJ13, KIR1.4, KIR7.1, LCA16, SVD
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 13
  KO
K05006  potassium inwardly-rectifying channel subfamily J member 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00805  Vitreoretinal degeneration
H00837  Leber congenital amaurosis
H02077  Snowflake vitreoretinal degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    3769 (KCNJ13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3769 (KCNJ13)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3769 (KCNJ13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK IRK_C Ion_trans_2 DUF3324
Motif
Other DBs
NCBI-GeneID: 3769
NCBI-ProteinID: NP_002233
OMIM: 603208
HGNC: 6259
Ensembl: ENSG00000115474
Vega: OTTHUMG00000153292
Pharos: O60928(Tbio)
UniProt: O60928
Position
2q37.1
AA seq 360 aa AA seqDB search
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH
MDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSDECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggacagcagtaattgcaaagttattgctcctctcctaagtcaaagataccggaggatg
gtcaccaaggatggccacagcacacttcaaatggatggcgctcaaagaggtcttgcatat
cttcgagatgcttggggaatcctaatggacatgcgctggcgttggatgatgttggtcttt
tctgcttcttttgttgtccactggcttgtctttgcagtgctctggtatgttctggctgag
atgaatggtgatctggaactagatcatgatgccccacctgaaaaccacactatctgtgtc
aagtatatcaccagtttcacagctgcattctccttctccctggagacacaactcacaatt
ggttatggtaccatgttccccagtggtgactgtccaagtgcaatcgccttacttgccata
caaatgctcctaggcctcatgctagaggcttttatcacaggtgcttttgtggcgaagatt
gcccggccaaaaaatcgagctttttcaattcgctttactgacacagcagtagtagctcac
atggatggcaaacctaatcttatcttccaagtggccaacacccgacctagccctctaacc
agtgtccgggtctcagctgtactctatcaggaaagagaaaatggcaaactctaccagacc
agtgtggatttccaccttgatggcatcagttctgacgaatgtccattcttcatctttcca
ctaacgtactatcactccattacaccatcaagtcctctggctactctgctccagcatgaa
aatccttctcactttgaattagttgtattcctttcagcaatgcaggagggcactggagaa
atatgccaaaggaggacatcctacctaccgtctgaaatcatgttacatcactgttttgca
tctctgttgacccgaggttccaaaggtgaatatcaaatcaagatggagaattttgacaag
actgtccctgaatttccaactcctctggtttctaaaagcccaaacaggactgacctggat
atccacatcaatggacaaagcattgacaattttcagatctctgaaacaggactgacagaa
taa

DBGET integrated database retrieval system