KEGG   Homo sapiens (human): 376940
Entry
376940            CDS       T01001                                 

Gene name
ZC3H6, ZC3HDC6
Definition
(RefSeq) zinc finger CCCH-type containing 6
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf_CCCH_4 zf-CCCH zf-CCCH_2 zf-CCCH_4 Torus zf-CCCH_3
Other DBs
NCBI-GeneID: 376940
NCBI-ProteinID: NP_940983
HGNC: 24762
Ensembl: ENSG00000188177
Vega: OTTHUMG00000153286
Pharos: P61129(Tdark)
UniProt: P61129 Q6ZN12
Position
2q14.1
AA seq 1189 aa
MTDSEHAGHDREDGELEDGEIDDAGFEEIQEKEAKENEKQKSEKAYRKSRKKHKKEREKK
KSKRRKREKHKHNSPSSDDSSDYSLDSDVEHTESSHKKRTGFYRDYDIPFTQRGHISGSY
ITSKKGQHNKKFKSKEYDEYSTYSDDNFGNYSDDNFGNYGQETEEDFANQLKQYRQAKET
SNIALGSSFSKESGKKQRMKGVQQGIEQRVKSFNVGRGRGLPKKIKRKERGGRTNKGPNV
FSVSDDFQEYNKPGKKWKVMTQEFINQHTVEHKGKQICKYFLEGRCIKGDQCKFDHDAEL
EKRKEICKFYLQGYCTKGENCIYMHNEFPCKFYHSGAKCYQGDNCKFSHDDLTKETKKLL
DKVLNTDEELINEDERELEELRKRGITPLPKPPPGVGLLPTPPEHFPFSDPEDDFQTDFS
DDFRKIPSLFEIVVKPTVDLAHKIGRKPPAFYTSASPPGPQFQGSSPHPQHIYSSGSSPG
PGPNMSQGHSSPVMHPGSPGHHPCAGPPGLPVPQSPPLPPGPPEIVGPQNQAGVLVQPDT
SLTPPSMGGAYHSPGFPGHVMKVPRENHCSPGSSYQQSPGEMQLNTNYESLQNPAEFYDN
YYAQHSIHNFQPPNNSGDGMWHGEFAQQQPPVVQDSPNHGSGSDGSSTRTGHGPLPVPGL
LPAVQRALFVRLTQRYQEDEEQTSTQPHRAPSKEEDDTVNWYSSSEEEEGSSVKSILKTL
QKQTETLRNQQQPSTELSTPTDPRLAKEKSKGNQVVDPRLRTIPRQDIRKPSESAPLDLR
LAWDPRKLRGNGSGHIGSSVGGAKFDLHHANAGTNVKHKRGDDDDEDTERELREKAFLIP
LDASPGIMLQDPRSQLRQFSHIKMDITLTKPNFAKHIVWAPEDLLPVPLPKPDPVSSINL
PLPPLIADQRLNRLWNTKSDLHQNTVSIDPKLAAKAKINTTNREGYLEQFGDSHGSGAKL
GDPRLQKNFDPRLHRLPNTESHQVVMKDSHASKGAPHLPRSNPGSSQPSGAGTSNSGSGA
LPPYAPKLSSSAGLPLGTSTSVLSGISLYDPRDHGSSSTSELATASSGENSKNQKKSGGL
KSSDKTEPSPGEAILPQKPSPNVGVTLEGPADPQADVPRSSGKVQVPAVHSLPVQALTGL
IRPQYSDPRQARQPGQGSPTPDNDPGRETDDKSLKEVFKTFDPTASPFC
NT seq 3570 nt   +upstreamnt  +downstreamnt
atgacagactctgaacatgcagggcacgacagagaagatggcgaattagaagatggtgaa
atagacgatgcaggatttgaagaaatacaagaaaaagaagcaaaagagaatgaaaagcag
aaaagtgagaaagcctacagaaaatcaagaaaaaaacataagaaagagagagagaagaaa
aaatccaaaaggagaaaacgtgagaaacataagcataattccccatctagtgatgatagt
tcggactacagccttgattcagatgttgaacatacagaaagttcccataaaaaaagaact
ggtttctacagggattatgacattccatttactcagcgtggacatatatcaggaagctac
ataacatcaaagaagggtcaacataacaaaaaatttaaaagtaaagaatatgatgagtac
agcacctacagtgatgacaacttcggtaactacagtgatgacaactttggtaactacggt
caggaaacagaggaagattttgccaatcagctgaaacaatacaggcaagctaaagaaacc
tcaaatattgctttagggtcatcattttctaaagaatcaggaaaaaaacagagaatgaaa
ggagttcagcaaggtattgaacagagagttaaaagttttaatgttggtcgtggacgtggc
ttgccgaagaaaatcaaacgaaaagaacgtgggggaagaaccaataaagggcctaatgtg
ttttcagtatcggatgactttcaagagtataataaaccagggaaaaaatggaaggttatg
actcaggaatttattaatcagcacacagtggaacacaaaggaaaacaaatctgtaaatac
ttcctggaagggaggtgtattaagggagatcagtgtaaatttgatcatgatgcagagttg
gagaaaagaaaagagatctgcaaattttatttacaaggatattgtaccaaaggagagaac
tgcatttatatgcataatgaatttccatgcaagttctatcatagtggagcaaaatgttac
cagggagacaactgtaaattttcccatgatgatctaactaaagaaacaaagaaacttttg
gacaaagtgttgaatactgatgaagaactcataaatgaagatgaaagagaattagaggaa
cttagaaagcgtggcataactcctcttcccaaaccacctccaggggttgggcttctgcca
acccctccagagcattttcccttttctgatcctgaagacgattttcagacagatttctct
gatgattttaggaaaattccatctctttttgaaatagttgtaaaacctactgtggattta
gcgcataaaattgggaggaagccaccagcattttataccagtgcctcaccaccaggacca
caatttcagggaagcagtccacaccctcaacatatctatagttctgggtcaagtccaggt
cctggacctaacatgtctcagggacacagtagtcctgtgatgcacccaggctcccctgga
catcacccatgtgcaggacctcctggtctaccagtgccacagagcccacctttaccacct
ggtccacctgaaattgtaggtcctcaaaatcaagctggagtgcttgttcaaccagacaca
tctttgacaccaccaagtatgggtggggcttaccactccccaggctttccaggacatgtg
atgaaagtacccagagagaatcactgttctccaggttcatcataccagcaaagtcctggt
gaaatgcagctcaacaccaattatgagtccctgcaaaacccagctgagttttacgataat
tactatgcacagcattctatacataattttcagccacccaataactctggtgatgggatg
tggcatggtgaatttgcccagcagcagcctcctgttgttcaagactcacctaaccatggg
agtgggtctgatggcagcagcactaggacaggccatggccctctgcctgtaccaggcctc
ctccctgcagtgcaaagagctctttttgtaagacttactcagagataccaagaagatgaa
gaacaaaccagcacccaacctcatagggcaccaagcaaggaagaagatgatacagttaac
tggtattccagtagtgaagaggaagaaggaagcagtgtcaaatcaatactgaaaacatta
cagaaacaaacagaaactttaaggaatcagcaacaaccttccacagaactcagcactcct
actgatccaagacttgctaaagagaaaagtaaaggaaaccaagtggttgaccctaggctt
aggactatcccaaggcaagacattagaaagccttctgagtctgccccactggatcttaga
cttgcgtgggatcccaggaaattgagagggaatggaagtggtcacataggctcttctgtt
ggtggagcaaagtttgatttgcatcatgcaaatgctggcactaatgtcaaacacaaaaga
ggcgatgatgatgatgaagatacagaaagagaactgagagaaaaagctttcttaatacct
ttggatgcctcacctggcataatgctccaggatccaaggtcacaattgagacagttcagt
cacattaaaatggacattactctaaccaaacccaactttgcaaaacacatcgtgtgggct
cccgaagacttacttccagtacctttacctaaacctgatccagtgtcttcaatcaattta
cctctgcccccacttatagctgaccagaggctaaatagattatggaatacaaaaagtgat
cttcatcaaaatacagtgtccattgatccaaaattagcagccaaagccaaaattaacaca
acaaacagagaaggctacctagaacaatttggagactcacacggttcaggagctaaatta
ggagatcctagactacaaaaaaattttgatcctaggcttcacagactgcccaatacagag
tctcatcaagtggttatgaaggattcacatgcatcaaagggtgcccctcacttacccaga
tcaaaccctggttcatcacagccctcaggggcaggaactagcaattctggttccggggct
ctgcctccatatgcccctaaactctcttcctcagctggccttccactgggaacttccact
tcagttcttagtggtattagtttgtatgaccctagggatcacggttcatcatccacatca
gagctagcaacagcttcttcaggagaaaactcaaagaaccagaaaaaaagtggtggctta
aaaagtagtgacaaaactgaaccttctcctggagaagccatccttccacaaaaacccagt
ccaaacgtgggagtcactcttgaggggccagctgacccacaggcggacgttcccaggagt
tctggtaaggttcaggtcccagcagtgcacagccttcctgttcaggcattaacaggctta
attaggccacagtacagtgatccaaggcaggcaaggcagccaggacaggggagcccgacc
ccagataatgatcccggtagagaaacagatgacaaatctctgaaagaggtttttaaaact
tttgatccaactgcttcaccattttgttag

DBGET integrated database retrieval system