KEGG   Homo sapiens (human): 377
Entry
377               CDS       T01001                                 

Gene name
ARF3
Definition
(RefSeq) ADP ribosylation factor 3
  KO
K07938  ADP-ribosylation factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    377 (ARF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    377 (ARF3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    377 (ARF3)
   04031 GTP-binding proteins [BR:hsa04031]
    377 (ARF3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    377 (ARF3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   377 (ARF3)
  Exosomal proteins of colorectal cancer cells
   377 (ARF3)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    377 (ARF3)
SSDB
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K CRISPR_Cas2
Other DBs
NCBI-GeneID: 377
NCBI-ProteinID: NP_001650
OMIM: 103190
HGNC: 654
Ensembl: ENSG00000134287
Vega: OTTHUMG00000168080
Pharos: P61204(Tbio)
UniProt: P61204 A0A024R0Y6
Structure
PDB: 
6II6

Position
12q13.12
AA seq 181 aa
MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK
K
NT seq 546 nt   +upstreamnt  +downstreamnt
atgggcaatatctttggaaaccttctcaagagcctgattgggaagaaggagatgcgcatc
ctgatggtgggcctggatgccgcaggaaagaccaccatcctatacaagctgaaactcggg
gagatcgtcaccaccatccctaccattgggttcaatgtggagacagtggagtataagaac
atcagctttacagtgtgggatgtgggtggccaggacaagattcgacccctctggagacac
tacttccagaacacccaagggttgatatttgtggtcgacagcaatgatcgggagcgagta
aatgaggcccgggaagagctgatgagaatgctggcggaggacgagctccgggatgctgta
ctccttgtctttgcaaacaaacaggatctgcctaatgctatgaacgctgctgagatcaca
gacaagctgggcctgcattcccttcgtcaccgtaactggtacattcaggccacctgtgcc
accagcggggacgggctgtacgaaggcctggactggctggccaatcagctcaaaaacaag
aagtga

DBGET integrated database retrieval system