KEGG   Homo sapiens (human): 3770Help
Entry
3770              CDS       T01001                                 

Gene name
KCNJ14, IRK4, KIR2.4
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 14
  KO
K05007  potassium inwardly-rectifying channel subfamily J member 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    3770 (KCNJ14)
  Nervous system
   04725 Cholinergic synapse
    3770 (KCNJ14)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3770 (KCNJ14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 3770
NCBI-ProteinID: NP_037480
OMIM: 603953
HGNC: 6260
Ensembl: ENSG00000182324
Vega: OTTHUMG00000183307
Pharos: Q9UNX9(Tdark)
UniProt: Q9UNX9
Position
19q13.33
AA seq 436 aa AA seqDB search
MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA
ASPRVLTPTLALTLPP
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggccagggccctacgccgcctcagcggcgccctggattcgggagacagccgg
gcgggcgatgaagaggaggccgggcccgggttgtgccgcaacgggtgggcgccggcaccg
gtgcagtcacccgtgggccggcgccgcggtcgcttcgtcaagaaagacgggcactgcaac
gtgcgtttcgtaaacctgggtggccagggcgcgcgctacctgagcgacctgttcaccaca
tgcgtggacgtgcgctggcgctggatgtgcctgctcttctcctgctccttcctcgcctcc
tggctgctcttcggcctggccttctggctcattgcctcgctgcacggcgacctggccgcc
ccgccaccgcccgcgccctgcttctcacacgtggccagcttcctggccgccttcctcttc
gcgctggagacgcagacgtccatcggctacggcgtgcgcagcgtcaccgaggagtgcccg
gccgctgtggccgccgtggtgctgcagtgcattgccggctgcgtgctcgacgccttcgtc
gtgggtgctgtcatggccaagatggccaaacccaagaagcgcaacgagacgctggtcttc
agcgagaacgccgtcgtggcgctgcgcgaccaccgcctctgcctcatgtggcgcgtcggc
aacctgcgccgcagccacctggtcgaggcccacgtgcgtgcccagctgctgcagccccgt
gtgaccccagagggtgagtacatcccgctggaccaccaggatgtggatgtgggctttgat
ggaggcaccgatcgtatcttcctcgtgtcccccatcaccatcgtccatgagatcgactct
gccagtcctctgtatgagctaggacgtgccgagctggccagggctgactttgagctggtg
gtcattctcgaggggatggttgaggccacagccatgaccacacagtgtcgctcgtcctac
ctccctggtgaactgctctggggccatcgttttgagccagttctcttccagcgtggctcc
cagtatgaggtcgactatcgccacttccatcgcacttatgaggtcccagggacaccggtc
tgcagtgctaaggagctggatgaacgggcagagcaggcttcccacagcctcaagtctagt
ttccccggctctctgactgcattttgttatgagaatgaacttgctctgagctgctgccag
gaggaagatgaggacgatgagactgaggaagggaatggggtggaaacagaagatggggct
gctagcccccgagttctcacaccaaccctggcgctgaccctgcctccatga

DBGET integrated database retrieval system