KEGG   Homo sapiens (human): 3772Help
Entry
3772              CDS       T01001                                 

Gene name
KCNJ15, IRKK, KIR1.3, KIR4.2
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 15
  KO
K05008  potassium inwardly-rectifying channel subfamily J member 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    3772 (KCNJ15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3772 (KCNJ15)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3772 (KCNJ15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2 DUF2182
Motif
Other DBs
NCBI-GeneID: 3772
NCBI-ProteinID: NP_001263364
OMIM: 602106
HGNC: 6261
Ensembl: ENSG00000157551
Vega: OTTHUMG00000090609
Pharos: Q99712(Tbio)
UniProt: Q99712
Position
21q22.13-q22.2
AA seq 375 aa AA seqDB search
MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ
RERELRTLLLQQSNV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgccattcacatcggcatgtccagcacccccctggtgaagcacactgctggggct
gggctcaaggccaacagaccccgcgtcatgtccaagagtgggcacagcaacgtgagaatt
gacaaagtggatggcatatacctactctacctgcaagacctgtggaccacagttatcgac
atgaagtggagatacaaactcaccctgttcgctgccacttttgtgatgacctggttcctt
tttggagtcatctactatgccatcgcgtttattcatggggacttagaacccggtgagccc
atttcaaatcataccccctgcatcatgaaagtggactctctcactggggcgtttctcttt
tccctggaatcccagacaaccattggctatggagtccgttccatcacagaggaatgtcct
catgccatcttcctgttggttgctcagttggtcatcacgaccttgattgagatcttcatc
accggaaccttcctggccaaaatcgccagacccaaaaagcgggctgagaccatcaagttc
agccactgtgcagtcatcaccaagcagaatgggaagctgtgcttggtgattcaggtagcc
aatatgaggaagagcctcttgattcagtgccagctctctggcaagctcctgcagacccac
gtcaccaaggagggggagcggattctcctcaaccaagccactgtcaaattccacgtggac
tcctcctctgagagccccttcctcattctgcccatgacattctaccatgtgctggatgag
acgagccccctgagagacctcacaccccaaaacctaaaggagaaggagtttgagcttgtg
gtcctcctcaatgccactgtggaatccaccagcgctgtctgccagagccgaacatcttat
atcccagaggaaatctactggggttttgagtttgtgcctgtggtatctctctccaaaaat
ggaaaatatgtggctgatttcagtcagtttgaacagattcggaaaagcccagattgcaca
ttttactgtgcagattctgagaaacagcaactcgaggagaagtacaggcaggaggatcag
agggaaagagaactgaggacacttttattacaacagagcaatgtctga

DBGET integrated database retrieval system