KEGG   Homo sapiens (human): 3776Help
Entry
3776              CDS       T01001                                 

Gene name
KCNK2, K2p2.1, TPKC1, TREK, TREK-1, TREK1, hTREK-1c, hTREK-1e
Definition
(RefSeq) potassium two pore domain channel subfamily K member 2
  KO
K04913  potassium channel subfamily K member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    3776 (KCNK2)
  09154 Digestive system
   04971 Gastric acid secretion
    3776 (KCNK2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    3776 (KCNK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3776 (KCNK2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   3776 (KCNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 3776
NCBI-ProteinID: NP_001017425
OMIM: 603219
HGNC: 6277
Ensembl: ENSG00000082482
Vega: OTTHUMG00000037017
Pharos: O95069(Tclin)
UniProt: O95069 Q6ZW95
Structure
PDB: 

Position
1q41
AA seq 426 aa AA seqDB search
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA
VIENIK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccagcgcctcgcgggagagacccggctatagagcaggagtggcggcacctgac
ttgctggatcctaaatctgccgctcagaactccaaaccgaggctctcgttttccacgaaa
cccacagtgcttgcttcccgggtggagagtgacacgaccattaatgttatgaaatggaag
acggtctccacgatattcctggtggttgtcctctatctgatcatcggagccaccgtgttc
aaagcattggagcagcctcatgagatttcacagaggaccaccattgtgatccagaagcaa
acattcatatcccaacattcctgtgtcaattcgacggagctggatgaactcattcagcaa
atagtggcagcaataaatgcagggattataccgttaggaaacacctccaatcaaatcagt
cactgggatttgggaagttccttcttctttgctggcactgttattacaaccataggattt
ggaaacatctcaccacgcacagaaggcggcaaaatattctgtatcatctatgccttactg
ggaattcccctctttggttttctcttggctggagttggagatcagctaggcaccatattt
ggaaaaggaattgccaaagtggaagatacgtttattaagtggaatgttagtcagaccaag
attcgcatcatctcaacaatcatatttatactatttggctgtgtactctttgtggctctg
cctgcgatcatattcaaacacatagaaggctggagtgccctggacgccatttattttgtg
gttatcactctaacaactattggatttggtgactacgttgcaggtggatccgatattgaa
tatctggacttctataagcctgtcgtgtggttctggatccttgtagggcttgcttacttt
gctgctgtcctgagcatgattggagattggctccgagtgatatctaaaaagacaaaagaa
gaggtgggagagttcagagcacacgctgctgagtggacagccaacgtcacagccgaattc
aaagaaaccaggaggcgactgagtgtggagatttatgacaagttccagcgggccacctcc
atcaagcggaagctctcggcagaactggctggaaaccacaatcaggagctgactccttgt
aggaggaccctgtcagtgaaccacctgaccagcgagagggatgtcttgcctcccttactg
aagactgagagtatctatctgaatggtttgacgccacactgtgctggtgaagagattgct
gtgattgagaacatcaaatag

DBGET integrated database retrieval system