KEGG   Homo sapiens (human): 3778Help
Entry
3778              CDS       T01001                                 

Gene name
KCNMA1, BKTM, CADEDS, KCa1.1, MaxiK, PNKD3, SAKCA, SLO, SLO-ALPHA, SLO1, bA205K10.1, hSlo, mSLO1
Definition
(RefSeq) potassium calcium-activated channel subfamily M alpha 1
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04911  Insulin secretion
hsa04924  Renin secretion
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
Disease
H01258  Generalized epilepsy and paroxysmal dyskinesia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    3778 (KCNMA1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3778 (KCNMA1)
   04924 Renin secretion
    3778 (KCNMA1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    3778 (KCNMA1)
  09154 Digestive system
   04970 Salivary secretion
    3778 (KCNMA1)
   04972 Pancreatic secretion
    3778 (KCNMA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3778 (KCNMA1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   3778 (KCNMA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Motif
Other DBs
NCBI-GeneID: 3778
NCBI-ProteinID: NP_001154824
OMIM: 600150
HGNC: 6284
Ensembl: ENSG00000156113
Vega: OTTHUMG00000018543
Pharos: Q12791(Tclin)
UniProt: Q12791
Structure
PDB: 

Position
10q22.3
AA seq 1236 aa AA seqDB search
MANGGGGGGGSSGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSSSSSS
VHEPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCH
CGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVL
VVLVFALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKL
WFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKL
VNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYA
KTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLES
VSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVK
IESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSW
NWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNE
MYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLG
FFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERD
CSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRAFEDEQPSTLSPKKKQRNGGMRNSPN
TSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSG
HVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVS
ILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIG
VLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDD
DPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEEN
ALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRL
RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSS
KKSSSVHSIPSTANRQNRPKSRESRDKQKYVQEERL
NT seq 3711 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatggtggcggcggcggcggcggcagcagcggcggcggcggcggcggcggaggc
agcagtcttagaatgagtagcaatatccacgcgaaccatctcagcctagacgcgtcctcc
tcctcctcctcctcctcttcctcttcttcttcttcctcctcctcttcctcctcgtcctcg
gtccacgagcccaagatggatgcgctcatcatcccggtgaccatggaggtgccgtgcgac
agccggggccaacgcatgtggtgggctttcctggcctcctccatggtgactttcttcggg
ggcctcttcatcatcttgctctggcggacgctcaagtacctgtggaccgtgtgctgccac
tgcgggggcaagacgaaggaggcccagaagattaacaatggctcaagccaggcggatggc
actctcaaaccagtggatgaaaaagaggaggcagtggccgccgaggtcggctggatgacc
tccgtgaaggactgggcgggggtgatgatatccgcccagacactgactggcagagtcctg
gttgtcttagtctttgctctcagcatcggtgcacttgtaatatacttcatagattcatca
aacccaatagaatcctgccagaatttctacaaagatttcacattacagatcgacatggct
ttcaacgtgttcttccttctctacttcggcttgcggtttattgcagccaacgataaattg
tggttctggctggaagtgaactctgtagtggatttcttcacggtgccccccgtgtttgtg
tctgtgtacttaaacagaagttggcttggtttgagatttttaagagctctgagactgata
cagttttcagaaattttgcagtttctgaatattcttaaaacaagtaattccatcaagctg
gtgaatctgctctccatatttatcagcacgtggctgactgcagccgggttcatccatttg
gtggagaattcaggggacccatgggaaaatttccaaaacaaccaggctctcacctactgg
gaatgtgtctatttactcatggtcacaatgtccaccgttggttatggggatgtttatgca
aaaaccacacttgggcgcctcttcatggtcttcttcatcctcgggggactggccatgttt
gccagctacgtccctgaaatcatagagttaataggaaaccgcaagaaatacgggggctcc
tatagtgcggttagtggaagaaagcacattgtggtctgcggacacatcactctggagagt
gtttccaacttcctgaaggactttctgcacaaggaccgggatgacgtcaatgtggagatc
gtttttcttcacaacatctcccccaacctggagcttgaagctctgttcaaacgacatttt
actcaggtggaattttatcagggttccgtcctcaatccacatgatcttgcaagagtcaag
atagagtcagcagatgcatgcctgatccttgccaacaagtactgcgctgacccggatgcg
gaggatgcctcgaatatcatgagagtaatctccataaagaactaccatccgaagataaga
atcatcactcaaatgctgcagtatcacaacaaggcccatctgctaaacatcccgagctgg
aattggaaagaaggtgatgacgcaatctgcctcgcagagttgaagttgggcttcatagcc
cagagctgcctggctcaaggcctctccaccatgcttgccaacctcttctccatgaggtca
ttcataaagattgaggaagacacatggcagaaatactacttggaaggagtctcaaatgaa
atgtacacagaatatctctccagtgccttcgtgggtctgtccttccctactgtttgtgag
ctgtgttttgtgaagctcaagctcctaatgatagccattgagtacaagtctgccaaccga
gagagccgtatattaattaatcctggaaaccatcttaagatccaagaaggtactttagga
tttttcatcgcaagtgatgccaaagaagttaaaagggcatttttttactgcaaggcctgt
catgatgacatcacagatcccaaaagaataaaaaaatgtggctgcaaacggcccaagatg
tccatctacaagagaatgagacgggcatgttgttttgattgcggacgttctgagcgtgac
tgctcatgcatgtcaggccgtgtgcgtggtaacgtggacacccttgagagagccttccca
ctttcttctgtctctgttaatgattgctccaccagtttccgtgcctttgaagatgagcag
ccgtcaacactatcaccaaaaaaaaagcaacggaatggaggcatgcggaactcacccaac
acctcgcctaagctgatgaggcatgaccccttgttaattcctggcaatgatcagattgac
aacatggactccaatgtgaagaagtacgactctactgggatgtttcactggtgtgcaccc
aaggagatagagaaagtcatcctgactcgaagtgaagctgccatgaccgtcctgagtggc
catgtcgtggtctgcatctttggcgacgtcagctcagccctgatcggcctccggaacctg
gtgatgccgctccgtgccagcaactttcattaccatgagctcaagcacattgtgtttgtg
ggctctattgagtacctcaagcgggaatgggagacgcttcataacttccccaaagtgtcc
atattgcctggtacgccattaagtcgggctgatttaagggctgtcaacatcaacctctgt
gacatgtgcgttatcctgtcagccaatcagaataatattgatgatacttcgctgcaggac
aaggaatgcatcttggcgtcactcaacatcaaatctatgcagtttgatgacagcatcgga
gtcttgcaggctaattcccaagggttcacacctccaggaatggatagatcctctccagat
aacagcccagtgcacgggatgttacgtcaaccatccatcacaactggggtcaacatcccc
atcatcactgaactagtgaacgatactaatgttcagtttttggaccaagacgatgatgat
gaccctgatacagaactgtacctcacgcagccctttgcctgtgggacagcatttgccgtc
agtgtcctggactcactcatgagcgcgacgtacttcaatgacaatatcctcaccctgata
cggaccctggtgaccggaggagccacgccggagctggaggctctgattgctgaggaaaac
gcccttagaggtggctacagcaccccgcagacactggccaatagggaccgctgccgcgtg
gcccagttagctctgctcgatgggccatttgcggacttaggggatggtggttgttatggt
gatctgttctgcaaagctctgaaaacatataatatgctttgttttggaatttaccggctg
agagatgctcacctcagcacccccagtcagtgcacaaagaggtatgtcatcaccaacccg
ccctatgagtttgagctcgtgccgacggacctgatcttctgcttaatgcagtttgaccac
aatgccggccagtcccgggccagcctgtcccattcctcccactcgtcgcagtcctccagc
aagaagagctcctctgttcactccatcccatccacagcaaaccgacagaaccggcccaag
tccagggagtcccgggacaaacagaagtacgtgcaggaagagcggctttga

DBGET integrated database retrieval system