KEGG   Homo sapiens (human): 3783Help
Entry
3783              CDS       T01001                                 

Gene name
KCNN4, DHS2, IK, IK1, IKCA1, KCA4, KCa3.1, SK4, hIKCa1, hKCa4, hSK4
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 4
  KO
K04945  potassium intermediate/small conductance calcium-activated channel subfamily N member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
hsa04929  GnRH secretion
hsa04970  Salivary secretion
hsa04974  Protein digestion and absorption
Disease
H00232  Hereditary stomatocytosis
H01978  Dehydrated hereditary stomatocytosis
Drug target
Senicapoc: D06640
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3783 (KCNN4)
   04929 GnRH secretion
    3783 (KCNN4)
  09154 Digestive system
   04970 Salivary secretion
    3783 (KCNN4)
   04974 Protein digestion and absorption
    3783 (KCNN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3783 (KCNN4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   3783 (KCNN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SK_channel CaMBD Ion_trans_2 Ion_trans
Motif
Other DBs
NCBI-GeneID: 3783
NCBI-ProteinID: NP_002241
OMIM: 602754
HGNC: 6293
Ensembl: ENSG00000104783
Vega: OTTHUMG00000182779
Pharos: O15554(Tchem)
UniProt: O15554
Structure
PDB: 

Position
19q13.31
AA seq 427 aa AA seqDB search
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggatctggtgcttggcctgggggccttgagacgccgaaagcgcttgctggag
caggagaagtctctggccggctgggcactggtgctggcaggaactggcattggactcatg
gtgctgcatgcagagatgctgtggttcggggggtgctcgtgggcgctctacctgttcctg
gttaaatgcacgatcagcatttccaccttcttactcctctgcctcatcgtggcctttcat
gccaaagaggtccagctgttcatgaccgacaacgggctgcgggactggcgcgtggcgctg
accgggcggcaggcggcgcagatcgtgctggagctggtggtgtgtgggctgcacccggcg
cccgtgcggggcccgccgtgcgtgcaggatttaggggcgccgctgacctccccgcagccc
tggccgggattcctgggccaaggggaagcgctgctgtccctggccatgctgctgcgtctc
tacctggtgccccgcgccgtgctcctgcgcagcggcgtcctgctcaacgcttcctaccgc
agcatcggcgctctcaatcaagtccgcttccgccactggttcgtggccaagctttacatg
aacacgcaccctggccgcctgctgctcggcctcacgcttggcctctggctgaccaccgcc
tgggtgctgtccgtggccgagaggcaggctgttaatgccactgggcacctttcagacaca
ctttggctgatccccatcacattcctgaccatcggctatggtgacgtggtgccgggcacc
atgtggggcaagatcgtctgcctgtgcactggagtcatgggtgtctgctgcacagccctg
ctggtggccgtggtggcccggaagctggagtttaacaaggcagagaagcacgtgcacaac
ttcatgatggatatccagtataccaaagagatgaaggagtccgctgcccgagtgctacaa
gaagcctggatgttctacaaacatactcgcaggaaggagtctcatgctgcccgcaggcat
cagcgcaagctgctggccgccatcaacgcgttccgccaggtgcggctgaaacaccggaag
ctccgggaacaagtgaactccatggtggacatctccaagatgcacatgatcctgtatgac
ctgcagcagaatctgagcagctcacaccgggccctggagaaacagattgacacgctggcg
gggaagctggatgccctgactgagctgcttagcactgccctggggccgaggcagcttcca
gaacccagccagcagtccaagtag

DBGET integrated database retrieval system