KEGG   Homo sapiens (human): 3786Help
Entry
3786              CDS       T01001                                 

Gene name
KCNQ3, BFNC2, EBN2, KV7.3
Definition
(RefSeq) potassium voltage-gated channel subfamily Q member 3
  KO
K04928  potassium voltage-gated channel KQT-like subfamily member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
Disease
H00806  Benign familial neonatal and infantile epilepsies
Drug target
Flindokalner: D04192
Retigabine: D09569
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    3786 (KCNQ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3786 (KCNQ3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3786 (KCNQ3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KCNQ_channel KCNQC3-Ank-G_bd Ion_trans Ion_trans_2 Lig_chan
Motif
Other DBs
NCBI-GeneID: 3786
NCBI-ProteinID: NP_004510
OMIM: 602232
HGNC: 6297
Ensembl: ENSG00000184156
Vega: OTTHUMG00000137472
Pharos: O43525(Tclin)
UniProt: O43525
Structure
PDB: 

Position
8q24.22
AA seq 872 aa AA seqDB search
MGLKARRAAGAAGGGGDGGGGGGGAANPAGGDAAAAGDEERKVGLAPGDVEQVTLALGAG
ADKDGTLLLEGGGRDEGQRRTPQGIGLLAKTPLSRPVKRNNAKYRRIQTLIYDALERPRG
WALLYHALVFLIVLGCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGC
CCRYKGWRGRLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRM
DRRGGTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKEEF
ETYADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQ
EQHRQKHFEKRRKPAAELIQAAWRYYATNPNRIDLVATWRFYESVVSFPFFRKEQLEAAS
SQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKA
YAFWQSSEDAGTGDPMAEDRGYGNDFPIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRP
YDVKDVIEQYSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTFPSQQSPR
NEPYVARPSTSEIEDQSMMGKFVKVERQVQDMGKKLDFLVDMHMQHMERLQVQVTEYYPT
KGTSSPAEAEKKEDNRYSDLKTIICNYSETGPPEPPYSFHQVTIDKVSPYGFFAHDPVNL
PRGGPSSGKVQATPPSSATTYVERPTVLPILTLLDSRVSCHSQADLQGPYSDRISPRQRR
SITRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYVFGPNGGSSWMREKRYLAEGETDT
DTDPFTPSGSMPLSSTGDGISDSVWTPSNKPI
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atggggctcaaggcgcgcagggcggcgggggcggctggcggcggcggcgacgggggcggc
ggaggcggcggggcggctaacccagccggaggggacgcggcggcggccggcgacgaggag
cggaaagtggggctggcgcccggcgacgtggagcaagtcaccttggcgctcggggccgga
gccgacaaagacgggaccctgctgctggagggcggcggccgcgacgaggggcagcggagg
accccgcagggcatcgggctcctggccaagaccccgctgagccgcccagtcaagagaaac
aacgccaagtaccggcgcatccaaactttgatctacgacgccctggagagaccgcggggc
tgggcgctgctttaccacgcgttggtgttcctgattgtcctggggtgcttgattctggct
gtcctgaccacattcaaggagtatgagactgtctcgggagactggcttctgttactggag
acatttgctattttcatctttggagccgagtttgctttgaggatctgggctgctggatgt
tgctgccgatacaaaggctggcggggccgactgaagtttgccaggaagcccctgtgcatg
ttggacatctttgtgctgattgcctctgtgccagtggttgctgtgggaaaccaaggcaat
gttctggccacctccctgcgaagcctgcgcttcctgcagatcctgcgcatgctgcggatg
gaccggagaggtggcacctggaagcttctgggctcagccatctgtgcccacagcaaagaa
ctcatcacggcctggtacatcggtttcctgacactcatcctttcttcatttcttgtctac
ctggttgagaaagacgtcccagaggtggatgcacaaggagaggagatgaaagaggagttt
gagacctatgcagatgccctgtggtggggcctgatcacactggccaccattggctatgga
gacaagacacccaaaacgtgggaaggccgtctgattgccgccaccttttccttaattggc
gtctccttttttgcccttccagcgggcatcctggggtccgggctggccctcaaggtgcag
gagcaacaccgtcagaagcactttgagaaaaggaggaagccagctgctgagctcattcag
gctgcctggaggtattatgctaccaaccccaacaggattgacctggtggcgacatggaga
ttttatgaatcagtcgtctcttttcctttcttcaggaaagaacagctggaggcagcatcc
agccaaaagctgggtctcttggatcgggttcgcctttctaatcctcgtggtagcaatact
aaaggaaagctatttacccctctgaatgtagatgccatagaagaaagtccttctaaagaa
ccaaagcctgttggcttaaacaataaagagcgtttccgcacggccttccgcatgaaagcc
tacgctttctggcagagttctgaagatgccgggacaggtgaccccatggcggaagacagg
ggctatgggaatgacttccccatcgaagacatgatccccaccctgaaggccgccatccga
gccgtcagaattctacaattccgtctctataaaaaaaaattcaaggagactttgaggcct
tacgatgtgaaggatgtgattgagcagtattctgccgggcatctcgacatgctttccagg
ataaagtaccttcagacgagaatagatatgattttcacccctggacctccctccacgcca
aaacacaagaagtctcagaaagggtcagcattcaccttcccatcccagcaatctcccagg
aatgaaccatatgtagccagaccatccacatcagaaatcgaagaccaaagcatgatgggg
aagtttgtaaaagttgaaagacaggttcaggacatggggaagaagctggacttcctcgtg
gatatgcacatgcaacacatggaacggttgcaggtgcaggtcacggagtattacccaacc
aagggcacctcctcgccagctgaagcagagaagaaggaggacaacaggtattccgatttg
aaaaccatcatctgcaactattctgagacaggccccccggaaccaccctacagcttccac
caggtgaccattgacaaagtcagcccctatgggttttttgcacatgaccctgtgaacctg
ccccgagggggacccagttctggaaaggttcaggcaactcctccttcctcagcaacaacg
tatgtggagaggcccacggtcctgcctatcttgactcttctcgactcccgagtgagctgc
cactcccaggctgacctgcagggcccctactcggaccgaatctccccccggcagagacgt
agcatcacgcgagacagtgacacacctctgtccctgatgtcggtcaaccacgaggagctg
gagaggtctccaagtggcttcagcatctcccaggacagagatgattatgtgttcggcccc
aatggggggtcgagctggatgagggagaagcggtacctcgccgagggtgagacggacaca
gacacggaccccttcacgcccagcggctccatgcctctgtcgtccacaggggatgggatt
tctgattcagtatggaccccttccaataagcccatttaa

DBGET integrated database retrieval system