KEGG   Homo sapiens (human): 3787
Entry
3787              CDS       T01001                                 

Gene name
KCNS1, Kv9.1
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily S member 1
  KO
K04931  potassium voltage-gated channel delayed-rectifier subfamily S member 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3787 (KCNS1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3787 (KCNS1)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2
Other DBs
NCBI-GeneID: 3787
NCBI-ProteinID: NP_001309728
OMIM: 602905
HGNC: 6300
Ensembl: ENSG00000124134
Vega: OTTHUMG00000033079
Pharos: Q96KK3(Tclin)
UniProt: Q96KK3 A2RUL8
Position
20q13.12
AA seq 526 aa
MLMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR
RQLSARALARFPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFYRT
GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC
PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH
SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF
FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST
GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT
TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQ
EFEDLLSSIDGVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgctgatgctgctggtccggggaacacactatgagaacctccggtctaaagtggtgctg
ccaacacccctaggagggaggagcactgaaacctttgtgagcgagttcccgggccccgac
accgggatccgctggcggcgaagcgacgaggcgctgcgcgtgaacgtgggtggcgtgcgg
cggcagctgagcgcgcgcgccctggcgcgcttcccgggcacgcggctgggccgcctgcag
gccgcggcgtcggaggagcaggcgcggcgcctgtgcgacgactacgacgaggcggcgcgc
gaattctacttcgaccggcacccgggcttcttcctgagcctgctgcacttctaccgcact
ggccacctgcacgtgctcgacgagctgtgcgtcttcgcctttggccaggaggccgactac
tggggcctaggcgagaacgcgcttgccgcgtgctgccgcgcgcgctacctggagaggcgg
ctgacccagccgcacgcctgggacgaggacagcgacacgccgagcagcgtggacccgtgc
cccgacgagatctccgacgtgcagcgagaactggcgcgctatggcgcggcgcgctgtggc
cgcctgcgccgccgcctctggctgaccatggagaacccgggctactcgctgccgagcaag
ctcttcagctgcgtctccatcagcgtggtgctcgcctccatcgccgccatgtgcatccac
agcctgcccgagtaccaggcccgcgaggcggcggccgccgtggctgcggtggccgcgggc
cgcagcccggaaggcgtgcgcgacgacccggtgctgcgacgcctcgagtacttctgcatc
gcctggttcagcttcgaggtgtcgtcgcgcctcctgctggcgcccagtacgcgcaacttc
ttctgccacccgctcaacctcatcgacattgtgtctgtgctgcccttctatctcacgctg
ctggctggtgtggcactgggcgaccagggcggcaaggagttcggccacctgggcaaggtg
gtgcaggtgttccgcctcatgcgcatcttccgcgtactcaagttggcgcgccattccacc
gggctgcgctcgctgggagccacgctcaagcacagctaccgtgaggtgggcatcttgctg
ctgtacctggctgtgggtgtgtcagtgttctctggtgtggcctacacagctgaaaaggag
gaggacgtgggctttaacaccatcccagcctgctggtggtggggcacagtgagcatgacc
accgtgggctatggggatgtggtgccagtgacggtggctggcaagctggcagcctcaggc
tgcatcctagggggcatcctggtggtagcactccccatcaccatcatcttcaacaagttc
tcccacttctaccggcgccagaaggctctggaggcagccgtgcgcaacagcaaccaccaa
gagtttgaggacttgctgagcagcattgatggggtgtcggaggcatctctggagacatcc
cgagaaacctctcaggagggacagtctgcagatctagagagccaggcccccagtgagcct
ccacaccctcagatgtattaa

DBGET integrated database retrieval system