KEGG   Homo sapiens (human): 378948Help
Entry
378948            CDS       T01001                                 

Gene name
RBMY1B, RBMY1D
Definition
(RefSeq) RNA binding motif protein Y-linked family 1 member B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RBM1CTR RRM_1 RRM_5 RRM_occluded Limkain-b1 BMP2K_C
Motif
Other DBs
NCBI-GeneID: 378948
NCBI-ProteinID: NP_001006121
HGNC: 23914
Ensembl: ENSG00000242875
Vega: OTTHUMG00000042045
Pharos: A6NDE4(Tbio)
UniProt: A6NDE4
Structure
PDB: 

Position
Yq11.223
AA seq 496 aa AA seqDB search
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPAD
AKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTR
GWLPSQEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGS
QGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAY
RDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNRRSSR
ETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYAYRDYGHSSWD
EHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREAYGSSSYVASI
VDGGESRSEKGDSSRY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtagaagcagatcatcctggcaagcttttcattggtggcctcaatagagaaaccaat
gagaagatgcttaaagcagtatttgggaaacatggtcccatatcagaagttcttttgata
aaggatcgaaccagcaaatccagaggctttgcatttattacttttgagaaccctgcagat
gctaagaatgctgccaaagatatgaatggaaagtctttgcatggaaaagcaataaaagta
gaacaagccaagaaaccatcttttcaaagtggtggtaggcggagaccaccagcttcttcg
agaaacagaagcccttcaggaagtctgagatctgcaagaggaagccgtggaggaacaaga
gggtggcttccctcacaagaagggcacctggatgatggtggatacactcctgatctcaag
atgagttattctaggggactcattccagttaaaagaggtccatcttcaagaagtggaggt
cctcctccgaaaaaatctgctccttctgctgtggcaagaagcaatagttggatgggaagc
caaggtcccatgtcacaaagaagagagaattatggagttcctccacgcagagcgacaata
tcttcctggagaaatgatcgcatgtcaacaagacatgatggttatgcaactaacgatgga
aatcatccaagttgccaagaaacgagggattatgctccaccatctagaggctatgcatac
cgtgataatggtcattctaatcgggatgaacattcctctagaggatatagaaatcatcga
agttcccgagaaactagggattatgctccaccatctagaggccatgcataccgtgattat
ggtcattctcgtcgggatgaaagttattctagaggatacagaaatcgtcgaagttcccga
gaaactagggagtatgctccaccatctagaggccatggataccgtgattatggtcattct
cgtcgacatgaaagttattctagaggatatagaaatcatccaagttcccgagaaaccagg
gattatgctccaccacatagagactatgcataccgtgattatggtcattctagttgggat
gaacattcctctagaggatatagttatcatgatggctacggtgaggcccttggtagagat
cattctgaacatctaagtggaagttcttatagagatgcacttcagagatacgggacctct
catggtgcaccacctgcaagagggcctcggatgtcttatggtggaagcacctgccacgca
tatagtaatacacgagatagatatggcagaagttgggagagttactcgagctgtggtgat
tttcattattgtgatcgtgagcatgtttgcagaaaagaccaaaggaatccgccttctctg
ggtagggtgctccctgatcctcgtgaagcatatggtagctcaagttatgtggcatctata
gtagatggtggggagagtcgatctgaaaaaggagactcgagcagatattaa

DBGET integrated database retrieval system