KEGG   Homo sapiens (human): 378949Help
Entry
378949            CDS       T01001                                 

Gene name
RBMY1D, RBM1, RBM2, RBMY1A1, YRRM1, YRRM2, hRBMY
Definition
(RefSeq) RNA binding motif protein Y-linked family 1 member D
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RBM1CTR RRM_1 RRM_5 RRM_occluded Limkain-b1 BMP2K_C
Motif
Other DBs
NCBI-GeneID: 378949
NCBI-ProteinID: NP_001006120
HGNC: 23915
Ensembl: ENSG00000244395
Vega: OTTHUMG00000043598
Pharos: P0C7P1(Tdark)
UniProt: P0C7P1
Structure
PDB: 

Position
Yq11.223
AA seq 496 aa AA seqDB search
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPAD
AKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTR
GWLPSQEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGS
QGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAY
RDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNRRSSR
ETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYAYRDYGHSSWD
EHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREACGSSSYVASI
VDGGESRSEKGDSSRY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtagaagcagatcatcctggcaagcttttcattggtggcctcaatagagaaaccaat
gagaagatgcttaaagcagtatttgggaaacatggtcccatatcagaagttcttttgata
aaggatcgaaccagcaaatccagaggctttgcatttattacttttgagaaccctgcagat
gctaagaatgctgccaaagatatgaatggaaagtctttgcatggaaaagcaataaaagta
gaacaagccaagaaaccatcttttcaaagtggtggtaggcggagaccaccagcttcttcg
agaaacagaagcccttcaggaagtctgagatctgcaagaggaagccgtggaggaacaaga
gggtggcttccctcacaagaagggcacctggatgatggtggatacactcctgatctcaag
atgagttattctaggggactcattccagttaaaagaggtccatcttcaagaagtggaggt
cctcctccgaaaaaatctgctccttctgctgtggcaagaagcaatagttggatgggaagc
caaggtcccatgtcacaaagaagagagaattatggagttcctccacgcagagcgacaata
tcttcctggagaaatgatcgcatgtcaacaagacatgatggttatgcaactaacgatgga
aatcatccaagttgccaagaaacgagggattatgctccaccatctagaggctatgcatac
cgtgataatggtcattctaatcgggatgaacattcctctagaggatatagaaatcatcga
agttcccgagaaactagggattatgctccaccatctagaggccatgcataccgtgattat
ggtcattctcgtcgggatgaaagttattctagaggatacagaaatcgtcgaagttcccga
gaaactagggagtatgctccaccatctagaggccatggataccgtgattatggtcattct
cgtcgacatgaaagttattctagaggatatagaaatcatccaagttcccgagaaaccagg
gattatgctccaccacatagagactatgcataccgtgattatggtcattctagttgggat
gaacattcctctagaggatatagttatcatgatggctacggtgaggcccttggtagagat
cattctgaacatctaagtggaagttcttatagagatgcacttcagagatacgggacctct
catggtgcaccacctgcaagagggcctcggatgtcctatggtggaagcacctgccacgca
tatagtaatacacgagatagatatggcagaagttgggagagttactcgagctgtggtgat
tttcattattgtgatcgtgagcatgtttgcagaaaagaccaaaggaatccgccttctctg
ggtagggtgctccctgatcctcgtgaagcatgtggtagctcaagttatgtggcatctata
gtagatggtggggagagtcgatctgaaaaaggagactcgagcagatattaa

DBGET integrated database retrieval system