KEGG   Homo sapiens (human): 3790Help
Entry
3790              CDS       T01001                                 

Gene name
KCNS3, KV9.3
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily S member 3
  KO
K04933  potassium voltage-gated channel delayed-rectifier subfamily S member 3
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3790 (KCNS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 BTB_3
Motif
Other DBs
NCBI-GeneID: 3790
NCBI-ProteinID: NP_001269357
OMIM: 603888
HGNC: 6302
Ensembl: ENSG00000170745
Vega: OTTHUMG00000044150
Pharos: Q9BQ31(Tclin)
UniProt: Q9BQ31
Position
2p24.2
AA seq 491 aa AA seqDB search
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR
YQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVR
LAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC
WWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID
VDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDIC
NTTSLENCTAK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttggtgagtttttccatcgccctggacaagacgaggaacttgtcaacctgaat
gtggggggctttaagcagtctgttgaccaaagcaccctcctgcggtttcctcacaccaga
ctggggaagctgcttacttgccattctgaagaggccattctggagctgtgtgatgattac
agtgtggccgataaggaatactactttgatcggaatccctccttgttcagatatgttttg
aatttttattacacggggaagctgcatgtcatggaggagctgtgcgtattctcattctgc
caggagatcgagtactggggcatcaacgagctcttcattgattcttgctgcagcaatcgc
taccaggaacgcaaggaggaaaaccacgagaaggactgggaccagaaaagccatgatgtg
agtaccgactcctcgtttgaagagtcgtctctgtttgagaaagagctggagaagtttgac
acactgcgatttggtcagctccggaagaaaatctggattagaatggagaatccagcgtac
tgcctgtccgctaagcttatcgctatctcctccttgagcgtggtgctggcctccatcgtg
gccatgtgcgttcacagcatgtcggagttccagaatgaggatggagaagtggatgatccg
gtgctggaaggagtggagatcgcgtgcattgcctggttcaccggggagcttgccgtccgg
ctggctgccgctccttgtcaaaagaaattctggaaaaaccctctgaacatcattgacttt
gtctctattattcccttctatgccacgttggctgtagacaccaaggaggaagagagtgag
gatattgagaacatgggcaaggtggtccagatcctacggcttatgaggattttccgaatt
ctaaagcttgcccggcactcggtaggacttcggtctctaggtgccacactgagacacagc
taccatgaagttgggcttctgcttctcttcctctctgtgggcatttccattttctctgtg
cttatctactccgtggagaaagatgaccacacatccagcctcaccagcatccccatctgc
tggtggtgggccaccatcagcatgacaactgtgggctatggagacacccacccggtcacc
ttggcgggaaagctcatcgccagcacatgcatcatctgtggcatcttggtggtggccctt
cccatcaccatcatcttcaacaagttttccaagtactaccagaagcaaaaggacattgat
gtggaccagtgcagtgaggatgcaccagagaagtgtcatgagctaccttactttaacatt
agggatatatatgcacagcggatgcacaccttcattaccagtctctcttctgtaggcatt
gtggtgagcgatcctgactccacagatgcttcaagcattgaagacaatgaggacatttgt
aacaccacctccttggagaattgcacagcaaaatga

DBGET integrated database retrieval system