KEGG   Homo sapiens (human): 3795Help
Entry
3795              CDS       T01001                                 

Gene name
KHK
Definition
(RefSeq) ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    3795 (KHK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3795 (KHK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     3795 (KHK)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3795 (KHK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Glyco_hydro_36N
Motif
Other DBs
NCBI-GeneID: 3795
NCBI-ProteinID: NP_000212
OMIM: 614058
HGNC: 6315
Ensembl: ENSG00000138030
Vega: OTTHUMG00000097077
Pharos: P50053(Tchem)
UniProt: P50053 A0A140VJM6
Structure
PDB: 

Position
2p23.3
AA seq 298 aa AA seqDB search
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDV
SATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELF
QLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaagcagatcctgtgcgtggggctagtggtgctggacgtcatcagcctggtg
gacaagtaccctaaggaggactcggagataaggtgtttgtcccagagatggcagcgcgga
ggcaacgcgtccaactcctgcaccgttctctccctgctcggagccccctgtgccttcatg
ggctcaatggctcctggccatgttgctgattttgtcctggatgacctccgccgctattct
gtggacctacgctacacagtctttcagaccacaggctccgtccccatcgccacggtcatc
atcaacgaggccagtggtagccgcaccatcctatactatgacaggagcctgccagatgtg
tctgctacagactttgagaaggttgatctgacccagttcaagtggatccacattgagggc
cggaacgcatcggagcaggtgaagatgctgcagcggatagacgcacacaacaccaggcag
cctccagagcagaagatccgggtgtccgtggaggtggagaagccacgagaggagctcttc
cagctgtttggctacggagacgtggtgtttgtcagcaaagatgtggccaagcacttgggg
ttccagtcagcagaggaagccttgaggggcttgtatggtcgtgtgaggaaaggggctgtg
cttgtctgtgcctgggctgaggagggcgccgacgccctgggccctgatggcaaattgctc
cactcggatgctttcccgccaccccgcgtggtggatacactgggagctggagacaccttc
aatgcctccgtcatcttcagcctctcccaggggaggagcgtgcaggaagcactgagattc
gggtgccaggtggccggcaagaagtgtggcctgcagggctttgatggcatcgtgtga

DBGET integrated database retrieval system