KEGG   Homo sapiens (human): 3798Help
Entry
3798              CDS       T01001                                 

Gene name
KIF5A, ALS25, D12S1889, MY050, NEIMY, NKHC, SPG10
Definition
(RefSeq) kinesin family member 5A
  KO
K10396  kinesin family member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04728  Dopaminergic synapse
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3798 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    3798 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3798 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3798 (KIF5A)
   04147 Exosome [BR:hsa04147]
    3798 (KIF5A)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    3798 (KIF5A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3798 (KIF5A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3798 (KIF5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd ATG16 Spc7
Motif
Other DBs
NCBI-GeneID: 3798
NCBI-ProteinID: NP_004975
OMIM: 602821
HGNC: 6323
Ensembl: ENSG00000155980
Vega: OTTHUMG00000170143
Pharos: Q12840(Tbio)
UniProt: Q12840
Structure
PDB: 

Position
12q13.3
AA seq 1032 aa AA seqDB search
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
ATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQETAAS
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaccaacaacgaatgtagcatcaaggtgctctgccgattccggcccctgaac
caggctgagattctgcggggagacaagttcatccccattttccaaggggacgacagcgtc
gttattggggggaagccatatgtttttgaccgtgtattccccccaaacacgactcaagag
caagtttatcatgcatgtgccatgcagattgtcaaagatgtccttgctggctacaatggc
accatttttgcttatggacagacatcctcagggaaaacacataccatggagggaaagctg
cacgaccctcagctgatgggaatcattcctcgaattgcccgagacatcttcaaccacatc
tactccatggatgagaaccttgagttccacatcaaggtttcttactttgaaatttacctg
gacaaaattcgtgaccttctggatgtgaccaagacaaatctgtccgtgcacgaggacaag
aaccgggtgccatttgtcaagggttgtactgaacgctttgtgtccagcccggaggagatt
ctggatgtgattgatgaagggaaatcaaatcgtcatgtggctgtcaccaacatgaatgaa
cacagctctcggagccacagcatcttcctcatcaacatcaagcaggagaacatggaaacg
gagcagaagctcagtgggaagctgtatctggtggacctggcagggagtgagaaggtcagc
aagactggagcagagggagccgtgctggacgaggcaaagaatatcaacaagtcactgtca
gctctgggcaatgtgatctccgcactggctgagggcactaaaagctatgttccatatcgt
gacagcaaaatgacaaggattctccaggactctctcgggggaaactgccggacgactatg
ttcatctgttgctcaccatccagttataatgatgcagagaccaagtccaccctgatgttt
gggcagcgggcaaagaccattaagaacactgcctcagtaaatttggagttgactgctgag
cagtggaagaagaaatatgagaaggagaaggagaagacaaaggcccagaaggagacgatt
gcgaagctggaggctgagctgagccggtggcgcaatggagagaatgtgcctgagacagag
cgcctggctggggaggaggcagccctgggagccgagctctgtgaggagacccctgtgaat
gacaactcatccatcgtggtgcgcatcgcgcccgaggagcggcagaaatacgaggaggag
atccgccgtctctataagcagcttgacgacaaggatgatgaaatcaaccaacaaagccaa
ctcatagagaagctcaagcagcaaatgctggaccaggaagagctgctggtgtccacccga
ggagacaacgagaaggtccagcgggagctgagccacctgcaatcagagaacgatgccgct
aaggatgaggtgaaggaagtgctgcaggccctggaggagctggctgtgaactatgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagcttctggtggatgagctgtct
cagaaggtggccaccatgctgtccctggagtctgagttgcagcggctacaggaggtcagt
ggacaccagcgaaaacgaattgctgaggtgctgaacgggctgatgaaggatctgagcgag
ttcagtgtcattgtgggcaacggggagattaagctgccagtggagatcagtggggccatc
gaggaggagttcactgtggcccgactctacatcagcaaaatcaaatcagaagtcaagtct
gtggtcaagcggtgccggcagctggagaacctccaggtggagtgtcaccgcaagatggaa
gtgaccgggcgggagctctcatcctgccagctcctcatctctcagcatgaggccaagatc
cgctcgcttacggaatacatgcagagcgtggagctaaagaagcggcacctggaagagtcc
tatgactccttgagcgatgagctggccaagctccaggcccaggaaactgtgcatgaagtg
gccctgaaggacaaggagcctgacactcaggatgcagatgaagtgaagaaggctctggag
ctgcagatggagagtcaccgggaggcccatcaccggcagctggcccggctccgggacgag
atcaacgagaagcagaagaccattgatgagctcaaagacctaaatcagaagctccagtta
gagctagagaagcttcaggctgactacgagaagctgaagagcgaagaacacgagaagagc
accaagctgcaggagctgacatttctgtacgagcgacatgagcagtccaagcaggacctc
aagggtctggaggagacagttgcccgggaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaagacagt
ggggggattcactcccaaaagcagaagatttcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttagggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgccatgaaggacaagcgccggtaccagcaggaggtggaccgcatc
aaggaggccgttcgctacaagagctcgggcaaacggggccattctgcccagattgccaaa
cccgtccggcctggccactacccagcatcctcacccaccaacccctatggcacccggagc
cctgagtgcatcagttacaccaacagcctcttccagaactaccagaatctctacctgcag
gccacacccagctccacctcagatatgtactttgcaaactcctgtaccagcagtggagcc
acatcttctggcggccccttggcttcctaccagaaggccaacatggacaatggaaatgcc
acagatatcaatgacaataggagtgacctgccgtgtggctatgaggctgaggaccaggcc
aagcttttccctctccaccaagagacagcagccagctaa

DBGET integrated database retrieval system