KEGG   Homo sapiens (human): 38Help
Entry
38                CDS       T01001                                 

Gene name
ACAT1, ACAT, MAT, T2, THIL
Definition
(RefSeq) acetyl-CoA acetyltransferase 1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00072  Synthesis and degradation of ketone bodies
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00380  Tryptophan metabolism
hsa00620  Pyruvate metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa00640  Propanoate metabolism
hsa00650  Butanoate metabolism
hsa00900  Terpenoid backbone biosynthesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01212  Fatty acid metabolism
Module
hsa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Disease
H01076  Alpha-methylacetoacetic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    38 (ACAT1)
   00630 Glyoxylate and dicarboxylate metabolism
    38 (ACAT1)
   00640 Propanoate metabolism
    38 (ACAT1)
   00650 Butanoate metabolism
    38 (ACAT1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    38 (ACAT1)
   00072 Synthesis and degradation of ketone bodies
    38 (ACAT1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    38 (ACAT1)
   00310 Lysine degradation
    38 (ACAT1)
   00380 Tryptophan metabolism
    38 (ACAT1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    38 (ACAT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    38 (ACAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     38 (ACAT1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   38 (ACAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 38
NCBI-ProteinID: NP_000010
OMIM: 607809
HGNC: 93
Ensembl: ENSG00000075239
Vega: OTTHUMG00000166381
Pharos: P24752(Tbio)
UniProt: P24752 A0A140VJX1
Structure
PDB: 

Position
11q22.3
AA seq 427 aa AA seqDB search
MAVLAALLRSGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLS
LLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCT
TINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIV
KDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTV
TVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADA
AKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVV
LANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGAS
AMLIQKL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgctggcggcacttctgcgcagcggcgcccgcagccgcagccccctgctccgg
aggctggtgcaggaaataagatatgtggaacggagttatgtatcaaaacccactttgaag
gaagtggtcatagtaagtgctacaagaacacccattggatcttttttaggcagcctttcc
ttgctgccagccactaagcttggttccattgcaattcagggagccattgaaaaggcaggg
attccaaaagaagaagtgaaagaagcatacatgggtaatgttctacaaggaggtgaagga
caagctcctacaaggcaggcagtattgggtgcaggcttacctatttctactccatgtacc
accataaacaaagtttgtgcttcaggaatgaaagccatcatgatggcctctcaaagtctt
atgtgtggacatcaggatgtgatggtggcaggtgggatggagagcatgtccaatgttcca
tatgtaatgaacagaggatcaacaccatatggtggggtaaagcttgaagatttgattgta
aaagacgggctaactgatgtctacaataaaattcatatgggcagctgtgctgagaataca
gcaaagaagctgaatattgcacgaaatgaacaggacgcttatgctattaattcttatacc
agaagtaaagcagcatgggaagctgggaaatttggaaatgaagttattcctgtcacagtt
acagtaaaaggtcaaccagatgtagtggtgaaagaagatgaagaatataaacgtgttgat
tttagcaaagttccaaagctgaagacagttttccagaaagaaaatggcacagtaacagct
gccaatgccagtacactgaatgatggagcagctgctctggttctcatgacggcagatgca
gcgaagaggctcaatgttacaccactggcaagaatagtagcatttgctgacgctgctgta
gaacctattgattttccaattgctcctgtatatgctgcatctatggttcttaaagatgtg
ggattgaaaaaagaagatattgcaatgtgggaagtaaatgaagcctttagtctggttgta
ctagcaaacattaaaatgttggagattgatccccaaaaagtgaatatcaatggaggagct
gtttctctgggacatccaattgggatgtctggagccaggattgttggtcatttgactcat
gccttgaagcaaggagaatacggtcttgccagtatttgcaatggaggaggaggtgcttct
gccatgctaattcagaagctgtag

DBGET integrated database retrieval system