KEGG   Homo sapiens (human): 3801
Entry
3801              CDS       T01001                                 
Symbol
KIFC3
Name
(RefSeq) kinesin family member C3
  KO
K10406  kinesin family member C2/C3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3801 (KIFC3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3801 (KIFC3)
SSDB
Motif
Pfam: Kinesin Microtub_bd NRBF2 DUF6638
Other DBs
NCBI-GeneID: 3801
NCBI-ProteinID: NP_005541
OMIM: 604535
HGNC: 6326
Ensembl: ENSG00000140859
Pharos: Q9BVG8(Tbio)
UniProt: Q9BVG8
Structure
Position
16:complement(57758217..57862858)
AA seq 833 aa
MVPSRRTWNLGATPSLRGLWRVGRAPEPEPGMARPAPAPASPAARPFPHTGPGRLRTGRG
KDTPVCGDEDSSARSAARPALAQCRALSVDWAGPGSPHGLYLTLQVEHLKEKLISQAQEV
SRLRSELGGTDLEKHRDLLMVENERLRQEMRRCEAELQELRTKPAGPCPGCEHSQESAQL
RDKLSQLQLEMAESKGMLSELNLEVQQKTDRLAEVELRLKDCLAEKAQEEERLSRRLRDS
HETIASLRAQSPPVKYVIKTVEVESSKTKQALSESQARNQHLQEQVAMQRQVLKEMEQQL
QSSHQLTARLRAQIAMYESELERAHGQMLEEMQSLEEDKNRAIEEAFARAQVEMKAVHEN
LAGVRTNLLTLQPALRTLTNDYNGLKRQVRGFPLLLQEALRSVKAEIGQAIEEVNSNNQE
LLRKYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIH
LLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEG
TAENPGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCP
DGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDC
STGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPF
RNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGLRRAELG
SWSSQEHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV
NT seq 2502 nt   +upstreamnt  +downstreamnt
atggtcccctctcgcaggacgtggaacctgggagccacgccctcgctgcggggcctgtgg
agagtgggccgggccccggagcccgagccggggatggctcgccccgccccagccccagcc
agcccggccgcccgccctttcccacacaccggcccggggaggttgagaactgggcgtgga
aaagataccccagtctgcggtgacgaggactccagtgcccgaagtgcagctcgcccagcc
ctagctcagtgccgagcccttagcgtggactgggctggccccggaagcccccacgggctc
tacctgaccctgcaggtagaacacctgaaggagaagctcattagccaggcccaggaagtg
agccgactgcgatctgagctggggggcaccgacttggagaagcaccgggacctgctgatg
gtggagaatgagcgactgaggcaggagatgcggcgctgtgaggccgagctgcaagagctg
cgcacaaagccagcaggtccctgcccaggttgtgagcacagccaggagagcgcccagctc
cgtgacaagctgtcccagctgcagctggagatggcggaaagcaaaggcatgctgtcagag
ctgaacctagaggtgcagcagaagaccgaccggctggctgaggtggagctgcgactcaag
gactgcctggctgagaaggcacaggaggaggagcggcttagtcggcgcctgcgtgacagc
cacgagaccattgccagcctgcgggcccagtccccacctgtcaagtatgtcatcaagaca
gtggaggtggagtcgtccaagaccaagcaggccctcagcgagtcccaggcccggaaccag
cacctgcaggagcaggtggctatgcagaggcaggtgctgaaggagatggaacagcagctg
cagagctcacaccagctgaccgcgcggctccgggcgcagattgccatgtacgagtcagag
ctggagcgggcccatgggcagatgctggaggagatgcagtccctggaagaggacaagaac
cgggccattgaggaggcctttgccagagcccaggtggagatgaaggctgtgcacgagaat
ctagcaggcgtccggaccaacttgctgaccttgcagccggcactgcggaccctcaccaac
gactacaatgggctcaagcggcaggtgcgcggcttcccactgctgctgcaggaggccctc
aggagtgtcaaggccgagataggccaggccatcgaggaggtcaacagcaacaaccaggag
ctgctgcgcaagtaccgccgcgagctgcagctgcgtaagaagtgccacaatgagctcgtg
cggctgaaagggaacatccgagtgattgctcgtgtccggccagtcaccaaagaggatggg
gaaggacctgaggccaccaatgctgtgactttcgatgccgacgacgactccatcatccac
ctgctgcacaagggcaagcctgtgtccttcgagctggacaaggtcttctccccacaggcc
tcgcagcaggacgtgttccaggaggtgcaggccctggtcacctcttgcattgatggcttc
aatgtctgcatctttgcgtacggccagacgggcgccggcaagacgtacacgatggagggg
accgctgagaacccaggtatcaaccagcgggccctgcagctgctcttctccgaggtgcag
gagaaggcgtctgactgggagtacaccatcaccgtcagcgctgcggagatctacaatgag
gtcctcagggacctgctagggaaagagcctcaggaaaaactggagatccggctgtgccca
gacggcagtgggcagctgtatgtaccagggctgactgagttccaagtgcagagcgtggac
gacatcaacaaggtgtttgagtttggccacactaatcgcacgaccgagttcaccaacctg
aacgagcacagctcccgctcgcacgcgctgctcatcgtgacggtgcgaggcgtggactgc
agcacaggcctccgcaccacggggaagctgaacctggtggacttggctggctcggagcgc
gtgggcaagtcgggggccgagggcagccgcctgcgggaggcgcagcacatcaacaagtcg
ctgtcggctctgggggacgtcattgctgccctgcgctcccgccagggccacgtgcccttc
cgcaactccaagctcacctacctgctgcaggattcgcttagtggtgacagcaagaccctc
atggtggtacaggtgtcccccgtggagaagaacactagcgagacgctctattccctcaag
tttgctgagagggtgcgctctgtggagctggggcctgggctacgcagggcagagcttggg
tcctggtcaagccaggagcatctagagtgggagccggcttgtcagacgccacagccctcg
gcacgggcccactcagcccccagctctgggaccagtagccgccctggatccatccggagg
aagctgcagccctcggggaagtcgcggccactgcctgtgtga

DBGET integrated database retrieval system