KEGG   Homo sapiens (human): 3802Help
Entry
3802              CDS       T01001                                 

Gene name
KIR2DL1, CD158A, KIR-K64, KIR221, KIR2DL3, NKAT, NKAT-1, NKAT1, p58.1
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1
  KO
K07981  killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3802 (KIR2DL1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3802 (KIR2DL1)
   04612 Antigen processing and presentation
    3802 (KIR2DL1)
 09160 Human Diseases
  09163 Immune diseases
   05332 Graft-versus-host disease
    3802 (KIR2DL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3802 (KIR2DL1)
CD molecules [BR:hsa04090]
 Proteins
  3802 (KIR2DL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2 DUF5589
Motif
Other DBs
NCBI-GeneID: 3802
NCBI-ProteinID: NP_055033
OMIM: 604936
HGNC: 6329
Ensembl: ENSG00000125498
Vega: OTTHUMG00000065885
Pharos: P43626(Tbio)
UniProt: P43626 Q6H2H3 Q6H2H2
Position
19q13.42
AA seq 348 aa AA seqDB search
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDI
VIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGT
FQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcttggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcagtgttggtcagatgtcatgtttgaacacttccttctg
cacagagaggggatgtttaacgacactttgcgcctcattggagaacaccatgatggggtc
tccaaggccaacttctccatcagtcgcatgacgcaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcaggtgtcagctcccagtgaccctctggacatc
gtgatcataggtctatatgagaaaccttctctctcagcccagctgggccccacggttctg
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggcccaaggtcaacggaaca
ttccaggctgactttcctctgggccctgccacccacggagggacctacagatgcttcggc
tctttccatgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcaggaaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

DBGET integrated database retrieval system