KEGG   Homo sapiens (human): 3803Help
Entry
3803              CDS       T01001                                 

Gene name
KIR2DL2, CD158B1, CD158b, NKAT-6, NKAT6, p58.2
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 2
  KO
K07981  killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3803 (KIR2DL2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3803 (KIR2DL2)
   04612 Antigen processing and presentation
    3803 (KIR2DL2)
 09160 Human Diseases
  09163 Immune diseases
   05332 Graft-versus-host disease
    3803 (KIR2DL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3803 (KIR2DL2)
CD molecules [BR:hsa04090]
 Proteins
  3803 (KIR2DL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2 DUF1510 SIT
Motif
Other DBs
NCBI-GeneID: 3803
NCBI-ProteinID: NP_055034
OMIM: 604937
HGNC: 6330
Pharos: P43627(Tdark)
UniProt: P43627 Q6H2H0 Q8N742
Structure
PDB: 

Position
19q13.4
AA seq 348 aa AA seqDB search
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttgagcacttccttctg
cacagagaagggaagtttaaggacactttgcacctcattggagagcaccatgatggggtc
tccaaagccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaatgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctctaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcagggaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

DBGET integrated database retrieval system