KEGG   Homo sapiens (human): 3815Help
Entry
3815              CDS       T01001                                 

Gene name
KIT, C-Kit, CD117, MASTC, PBT, SCFR
Definition
(RefSeq) KIT proto-oncogene receptor tyrosine kinase
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04916  Melanogenesis
hsa05200  Pathways in cancer
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05230  Central carbon metabolism in cancer
Network
N00003  Mutation-activated KIT to RAS-ERK signaling pathway
N00045  KITLG-KIT-PI3K signaling pathway
N00046  Mutation-activated KIT to PI3K signaling pathway
N00215  KITLG-KIT-RAS-ERK signaling pathway
Disease
H00003  Acute myeloid leukemia (AML)
H00031  Breast cancer
H00170  Piebaldism
H01359  Anaphylaxis
H01511  Mast-cell leukemia
H01591  Gastrotintestinal stromal tumor
Drug target
Amuvatinib (DG01916): D09864 D09865
Ancestim: D02937
Cabozantinib (DG01670): D10062 D10095
Dasatinib (DG00714): D03658 D06414
Dovitinib lactate: D08907
Imatinib (DG00710): D01441 D08066
Masitinib: D10229
Midostaurin: D05029
Motesanib (DG01262): D06678 D08947
Nilotinib (DG00716): D06413 D08953
Pazopanib: D05380
Regorafenib (DG00720): D10137 D10138
Semaxanib: D05819
Sorafenib (DG00713): D06272 D08524
Sunitinib (DG00712): D06402 D08552
Tandutinib: D06005
Toceranib (DG01363): D08503 D08544
Vatalanib: D06285
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    3815 (KIT)
   04015 Rap1 signaling pathway
    3815 (KIT)
   04010 MAPK signaling pathway
    3815 (KIT)
   04072 Phospholipase D signaling pathway
    3815 (KIT)
   04151 PI3K-Akt signaling pathway
    3815 (KIT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3815 (KIT)
  09152 Endocrine system
   04916 Melanogenesis
    3815 (KIT)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3815 (KIT)
   05230 Central carbon metabolism in cancer
    3815 (KIT)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    3815 (KIT)
   05224 Breast cancer
    3815 (KIT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3815 (KIT)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3815 (KIT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3815 (KIT)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   3815 (KIT)
CD molecules [BR:hsa04090]
 Proteins
  3815 (KIT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 ig I-set Ig_2 Ig_4 V-set APH
Motif
Other DBs
NCBI-GeneID: 3815
NCBI-ProteinID: NP_000213
OMIM: 164920
HGNC: 6342
Ensembl: ENSG00000157404
Vega: OTTHUMG00000128713
Pharos: P10721(Tclin)
UniProt: P10721 A0A024RDA0
Structure
PDB: 

Position
4q12
AA seq 976 aa AA seqDB search
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggattttctctgcgttctgctcctactgcttcgcgtc
cagacaggctcttctcaaccatctgtgagtccaggggaaccgtctccaccatccatccat
ccaggaaaatcagacttaatagtccgcgtgggcgacgagattaggctgttatgcactgat
ccgggctttgtcaaatggacttttgagatcctggatgaaacgaatgagaataagcagaat
gaatggatcacggaaaaggcagaagccaccaacaccggcaaatacacgtgcaccaacaaa
cacggcttaagcaattccatttatgtgtttgttagagatcctgccaagcttttccttgtt
gaccgctccttgtatgggaaagaagacaacgacacgctggtccgctgtcctctcacagac
ccagaagtgaccaattattccctcaaggggtgccaggggaagcctcttcccaaggacttg
aggtttattcctgaccccaaggcgggcatcatgatcaaaagtgtgaaacgcgcctaccat
cggctctgtctgcattgttctgtggaccaggagggcaagtcagtgctgtcggaaaaattc
atcctgaaagtgaggccagccttcaaagctgtgcctgttgtgtctgtgtccaaagcaagc
tatcttcttagggaaggggaagaattcacagtgacgtgcacaataaaagatgtgtctagt
tctgtgtactcaacgtggaaaagagaaaacagtcagactaaactacaggagaaatataat
agctggcatcacggtgacttcaattatgaacgtcaggcaacgttgactatcagttcagcg
agagttaatgattctggagtgttcatgtgttatgccaataatacttttggatcagcaaat
gtcacaacaaccttggaagtagtagataaaggattcattaatatcttccccatgataaac
actacagtatttgtaaacgatggagaaaatgtagatttgattgttgaatatgaagcattc
cccaaacctgaacaccagcagtggatctatatgaacagaaccttcactgataaatgggaa
gattatcccaagtctgagaatgaaagtaatatcagatacgtaagtgaacttcatctaacg
agattaaaaggcaccgaaggaggcacttacacattcctagtgtccaattctgacgtcaat
gctgccatagcatttaatgtttatgtgaatacaaaaccagaaatcctgacttacgacagg
ctcgtgaatggcatgctccaatgtgtggcagcaggattcccagagcccacaatagattgg
tatttttgtccaggaactgagcagagatgctctgcttctgtactgccagtggatgtgcag
acactaaactcatctgggccaccgtttggaaagctagtggttcagagttctatagattct
agtgcattcaagcacaatggcacggttgaatgtaaggcttacaacgatgtgggcaagact
tctgcctattttaactttgcatttaaaggtaacaacaaagagcaaatccatccccacacc
ctgttcactcctttgctgattggtttcgtaatcgtagctggcatgatgtgcattattgtg
atgattctgacctacaaatatttacagaaacccatgtatgaagtacagtggaaggttgtt
gaggagataaatggaaacaattatgtttacatagacccaacacaacttccttatgatcac
aaatgggagtttcccagaaacaggctgagttttgggaaaaccctgggtgctggagctttc
gggaaggttgttgaggcaactgcttatggcttaattaagtcagatgcggccatgactgtc
gctgtaaagatgctcaagccgagtgcccatttgacagaacgggaagccctcatgtctgaa
ctcaaagtcctgagttaccttggtaatcacatgaatattgtgaatctacttggagcctgc
accattggagggcccaccctggtcattacagaatattgttgctatggtgatcttttgaat
tttttgagaagaaaacgtgattcatttatttgttcaaagcaggaagatcatgcagaagct
gcactttataagaatcttctgcattcaaaggagtcttcctgcagcgatagtactaatgag
tacatggacatgaaacctggagtttcttatgttgtcccaaccaaggccgacaaaaggaga
tctgtgagaataggctcatacatagaaagagatgtgactcccgccatcatggaggatgac
gagttggccctagacttagaagacttgctgagcttttcttaccaggtggcaaagggcatg
gctttcctcgcctccaagaattgtattcacagagacttggcagccagaaatatcctcctt
actcatggtcggatcacaaagatttgtgattttggtctagccagagacatcaagaatgat
tctaattatgtggttaaaggaaacgctcgactacctgtgaagtggatggcacctgaaagc
attttcaactgtgtatacacgtttgaaagtgacgtctggtcctatgggatttttctttgg
gagctgttctctttaggaagcagcccctatcctggaatgccggtcgattctaagttctac
aagatgatcaaggaaggcttccggatgctcagccctgaacacgcacctgctgaaatgtat
gacataatgaagacttgctgggatgcagatcccctaaaaagaccaacattcaagcaaatt
gttcagctaattgagaagcagatttcagagagcaccaatcatatttactccaacttagca
aactgcagccccaaccgacagaagcccgtggtagaccattctgtgcggatcaattctgtc
ggcagcaccgcttcctcctcccagcctctgcttgtgcacgacgatgtctga

DBGET integrated database retrieval system