KEGG   Homo sapiens (human): 3820Help
Entry
3820              CDS       T01001                                 

Gene name
KLRB1, CD161, CLEC5B, NKR, NKR-P1, NKR-P1A, NKRP1A, hNKR-P1A
Definition
(RefSeq) killer cell lectin like receptor B1
  KO
K06543  killer cell lectin-like receptor subfamily B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05144 Malaria
    3820 (KLRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3820 (KLRB1)
   04091 Lectins [BR:hsa04091]
    3820 (KLRB1)
CD molecules [BR:hsa04090]
 Proteins
  3820 (KLRB1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   3820 (KLRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C
Motif
Other DBs
NCBI-GeneID: 3820
NCBI-ProteinID: NP_002249
OMIM: 602890
HGNC: 6373
Ensembl: ENSG00000111796
Vega: OTTHUMG00000168581
Pharos: Q12918(Tbio)
UniProt: Q12918
Structure
PDB: 

Position
12p13.31
AA seq 225 aa AA seqDB search
MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSV
SVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLA
DCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEI
RGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacaagcaatatatgctgagttaaacttacccacagactcaggcccagaaagt
tcttcaccttcatctcttcctcgggatgtctgtcagggttcaccttggcatcaatttgcc
ctgaaacttagctgtgctgggattattctccttgtcttggttgttactgggttgagtgtt
tcagtgacatccttaatacagaaatcatcaatagaaaaatgcagtgtggacattcaacag
agcaggaataaaacaacagagagaccgggtctcttaaactgcccaatatattggcagcaa
ctccgagagaaatgcttgttattttctcacactgtcaacccttggaataacagtctagct
gattgttccaccaaagaatccagcctgctgcttattcgagataaggatgaattgatacac
acacagaacctgatacgtgacaaagcaattctgttttggattggattaaatttttcatta
tcagaaaagaactggaagtggataaacggctcttttttaaattctaatgacttagaaatt
agaggtgatgctaaagaaaacagctgtatttccatctcacagacatctgtgtattctgag
tactgtagtacagaaatcagatggatctgccaaaaagaactaacacctgtgagaaataaa
gtgtatcctgactcttga

DBGET integrated database retrieval system