KEGG   Homo sapiens (human): 3821
Entry
3821              CDS       T01001                                 

Symbol
KLRC1, CD159A, NKG2, NKG2A
Name
(RefSeq) killer cell lectin like receptor C1
  KO
K06541  killer cell lectin-like receptor subfamily C1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3821 (KLRC1)
   04612 Antigen processing and presentation
    3821 (KLRC1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3821 (KLRC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3821 (KLRC1)
   04091 Lectins [BR:hsa04091]
    3821 (KLRC1)
CD molecules [BR:hsa04090]
 Proteins
  3821 (KLRC1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   3821 (KLRC1)
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 3821
NCBI-ProteinID: NP_002250
OMIM: 161555
HGNC: 6374
Ensembl: ENSG00000134545
Vega: OTTHUMG00000168584
Pharos: P26715(Tbio)
UniProt: P26715
Structure
PDB: 
3BDW 3CDG 3CII

Position
12p13.2
AA seq 233 aa
MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYH
CKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCP
EEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRN
SSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
NT seq 702 nt   +upstreamnt  +downstreamnt
atggataaccaaggagtaatctactcagacctgaatctgcccccaaacccaaagaggcag
caacgaaaacctaaaggcaataaaaactccattttagcaactgaacaggaaataacctat
gcggaattaaaccttcaaaaagcttctcaggattttcaagggaatgacaaaacctatcac
tgcaaagatttaccatcagctccagagaagctcattgttgggatcctgggaattatctgt
cttatcttaatggcctctgtggtaacgatagttgttattccctctacattaatacagagg
cacaacaattcttccctgaatacaagaactcagaaagcacgtcattgtggccattgtcct
gaggagtggattacatattccaacagttgttactacattggtaaggaaagaagaacttgg
gaagagagtttgctggcctgtacttcgaagaactccagtctgctttctatagataatgaa
gaagaaatgaaatttctgtccatcatttcaccatcctcatggattggtgtgtttcgtaac
agcagtcatcatccatgggtgacaatgaatggtttggctttcaaacatgagataaaagac
tcagataatgctgaacttaactgtgcagtgctacaagtaaatcgacttaaatcagcccag
tgtggatcttcaataatatatcattgtaagcataagctttag

DBGET integrated database retrieval system