KEGG   Homo sapiens (human): 3822
Entry
3822              CDS       T01001                                 

Gene name
KLRC2, CD159c, NKG2-C, NKG2C
Definition
(RefSeq) killer cell lectin like receptor C2
  KO
K24233  killer cell lectin-like receptor subfamily C2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3822 (KLRC2)
   04612 Antigen processing and presentation
    3822 (KLRC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3822 (KLRC2)
   04091 Lectins [BR:hsa04091]
    3822 (KLRC2)
CD molecules [BR:hsa04090]
 Proteins
  3822 (KLRC2)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   3822 (KLRC2)
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 3822
NCBI-ProteinID: NP_002251
OMIM: 602891
HGNC: 6375
Ensembl: ENSG00000205809
Vega: OTTHUMG00000168532
Pharos: P26717(Tbio)
UniProt: P26717
Position
12p13.2
AA seq 231 aa
MNKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYD
CQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQNNFSPNTRTQKARHCGHCPEE
WITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSS
HHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
NT seq 696 nt   +upstreamnt  +downstreamnt
atgaataaacaaagaggaaccttctcagaagtgagtctggcccaggacccaaagcggcag
caaaggaaacctaaaggcaataaaagctccatttcaggaaccgaacaggaaatattccaa
gtagaattaaatcttcaaaatccttccctgaatcatcaagggattgataaaatatatgac
tgccaaggtttactgccacctccagagaagctcactgccgaggtcctaggaatcatttgc
attgtcctgatggccactgtgttaaaaacaatagttcttattcctttcctggagcagaac
aatttttccccgaatacaagaacgcagaaagcacgtcattgtggccattgtcctgaggag
tggattacatattccaacagttgttattacattggtaaggaaagaagaacttgggaagag
agtttgctggcctgtacttcgaagaactccagtctgctttctatagataatgaagaagaa
atgaaatttctggccagcattttaccttcctcatggattggtgtgtttcgtaacagcagt
catcatccatgggtgacaataaatggtttggctttcaaacataagataaaagactcagat
aatgctgaacttaactgtgcagtgctacaagtaaatcgacttaaatcagcccagtgtgga
tcttcaatgatatatcattgtaagcataagctttag

DBGET integrated database retrieval system