KEGG   Homo sapiens (human): 3824
Entry
3824              CDS       T01001                                 

Gene name
KLRD1, CD94
Definition
(RefSeq) killer cell lectin like receptor D1
  KO
K06516  killer cell lectin-like receptor subfamily D member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3824 (KLRD1)
   04612 Antigen processing and presentation
    3824 (KLRD1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3824 (KLRD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3824 (KLRD1)
   04091 Lectins [BR:hsa04091]
    3824 (KLRD1)
CD molecules [BR:hsa04090]
 Proteins
  3824 (KLRD1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   3824 (KLRD1)
SSDB
Motif
Pfam: Lectin_C Chordopox_A33R Ly49
Other DBs
NCBI-GeneID: 3824
NCBI-ProteinID: NP_001107868
OMIM: 602894
HGNC: 6378
Ensembl: ENSG00000134539
Vega: OTTHUMG00000168419
Pharos: Q13241(Tbio)
UniProt: Q13241 Q53ZY6
Structure
PDB: 
3BDW 1B6E 3CDG 3CII

Position
12p13.2
AA seq 179 aa
MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCS
CQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLS
YSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcagtgtttaagaccactctgtggaggttaatttctgggaccttagggataatatgc
ctttcgttgatgtctacgttgggaattttgttgaaaaattcttttactaaactgagtatt
gagccagcatttactccaggacccaacatagaactccagaaagactctgactgctgttct
tgccaagaaaaatgggttgggtaccggtgcaactgttacttcatttccagtgaacagaaa
acttggaacgaaagtcggcatctctgtgcttctcagaaatccagcctgcttcagcttcaa
aacacagatgaactggattttatgagctccagtcaacaattttactggattggactctct
tacagtgaggagcacaccgcctggttgtgggagaatggctctgcactctcccagtatcta
tttccatcatttgaaacttttaatacaaagaactgcatagcgtataatccaaatggaaat
gctttagatgaatcctgtgaagataaaaatcgttatatctgtaagcaacagctcatttaa

DBGET integrated database retrieval system