KEGG   Homo sapiens (human): 3833
Entry
3833              CDS       T01001                                 
Symbol
KIFC1, HSET, KNSL2
Name
(RefSeq) kinesin family member C1
  KO
K10405  kinesin family member C1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3833 (KIFC1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3833 (KIFC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    3833 (KIFC1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3833 (KIFC1)
SSDB
Motif
Pfam: Kinesin Microtub_bd Crescentin ATG16 HAP1_N Rootletin TACC_C CENP-F_leu_zip DUF2312 MAD CCDC22 IFT57 CC149 GAS
Other DBs
NCBI-GeneID: 3833
NCBI-ProteinID: NP_002254
OMIM: 603763
HGNC: 6389
Ensembl: ENSG00000237649
Pharos: Q9BW19(Tchem)
UniProt: Q9BW19 A0A024RCS7
Structure
Position
6:33391461..33409896
AA seq 673 aa
MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATT
KITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIATGLKNQKPVPAVPVQKSGTS
GVPPMAGGKKPSKRPAWDLKGQLCDLNAELKRCRERTQTLDQENQQLQDQLRDAQQQVKA
LGTERTTLEGHLAKVQAQAEQGQQELKNLRACVLELEERLSTQEGLVQELQKKQVELQEE
RRGLMSQLEEKERRLQTSEAALSSSQAEVASLRQETVAQAALLTEREERLHGLEMERRRL
HNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSLSRSDERRGTL
SGAPAPPTRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTM
EGGPGGDPQLEGLIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKG
QGGECEIRRAGPGSEELTVTNARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHS
VFQLQISGEHSSRGLQCGAPLSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLG
LVIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKV
NQCVIGTAQANRK
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggatccgcagaggtcccccctattggaagtaaaggggaacatagaactgaagagacct
ctgattaaggccccttcccagctgcctctctcaggaagcagactcaagaggaggcctgac
cagatggaagatggcctggagcctgagaagaaacggacaagaggcctgggtgcaacgacc
aaaattaccacatcccacccaagagttccatccctcactacagtgccacagacacaaggc
cagaccacagctcaaaaagtttccaagaagacaggaccccggtgttccacagctattgcc
acagggttgaagaaccagaagccagttcctgctgttcctgtccagaagtctggcacatca
ggtgttcctcccatggcaggagggaagaaacccagcaaacgtccagcctgggacttaaag
ggtcagttatgtgacctaaatgcagaactaaaacggtgccgtgagaggactcaaacgttg
gaccaagagaaccagcagcttcaggaccagctcagagatgcccagcagcaggtcaaggcc
ctggggacagagcgcacaacactggaggggcatttagccaaggtacaggcccaggctgag
cagggccaacaggagctgaagaacttgcgtgcttgtgtcctggagctggaagagcggctg
agcacgcaggagggcttggtgcaagagcttcagaaaaaacaggtggaattgcaggaagaa
cggaggggactgatgtcccaactagaggagaaggagaggaggctgcagacatcagaagca
gccctgtcaagcagccaagcagaggtggcatctctgcggcaggagactgtggcccaggca
gccttactgactgagcgggaagaacgtcttcatgggctagaaatggagcgccggcgactg
cacaaccagctgcaggaactcaagggcaacatccgtgtattctgccgggtccgccctgtc
ctgccgggggagcccactccaccccctggcctcctcctgtttccctctggccctggtggg
ccctctgatcctccaacccgccttagcctctcccggtctgacgagcggcgtgggaccctg
agtggggcaccagctcccccaactcgccatgatttttcctttgaccgggtattcccacca
ggaagtggacaggatgaagtgtttgaagagattgccatgcttgtccagtcagccctggat
ggctatccagtatgcatctttgcctatggccagacaggcagtggcaagaccttcacaatg
gagggtgggcctgggggagacccccagttggaggggctgatccctcgggccctgcggcac
ctcttctctgtggctcaggagctgagtggtcagggctggacctacagctttgtagcaagc
tacgtagagatctacaatgagactgtccgggacctgctggccactggaacccggaagggt
caagggggcgagtgtgagattcgccgtgcagggccagggagtgaggagctcactgtcacc
aatgctcgatatgtccctgtctcctgtgagaaagaagtggacgccctgcttcatctggcc
cgccagaatcgggctgtggcccgcacagcccagaatgaacggtcatcacgcagccacagt
gtattccagctacagatttctggggagcactccagccgaggcctgcagtgtggggccccc
ctcagtcttgtggacctggccgggagtgagcgacttgaccccggcttagccctcggcccc
ggggagcgggaacgccttcgggaaacacaggccattaacagcagcctgtccacgctgggg
ctggttatcatggccctgagcaacaaggagtcccacgtgccttaccggaacagcaaactg
acctacctgctgcagaactctctgggtggtagtgctaagatgctcatgtttgtgaacatt
tctccactggaagagaacgtctccgagtccctcaactctctacgctttgcctccaaggtg
aaccagtgtgttattggtactgctcaggccaacaggaagtga

DBGET integrated database retrieval system