KEGG   Homo sapiens (human): 3833Help
Entry
3833              CDS       T01001                                 

Gene name
KIFC1, HSET, KNSL2
Definition
(RefSeq) kinesin family member C1
  KO
K10405  kinesin family member C1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3833 (KIFC1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3833 (KIFC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    3833 (KIFC1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3833 (KIFC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd ATG16 UPF0242 CENP-F_leu_zip DUF812 IFT57 Rootletin GAS MAD TACC_C GIT_CC DUF2046 DUF2353 APG6_N
Motif
Other DBs
NCBI-GeneID: 3833
NCBI-ProteinID: NP_002254
OMIM: 603763
HGNC: 6389
Ensembl: ENSG00000237649
Vega: OTTHUMG00000031209
Pharos: Q9BW19(Tchem)
UniProt: Q9BW19 A0A024RCS7
Structure
PDB: 

Position
6p21.32
AA seq 673 aa AA seqDB search
MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATT
KITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIATGLKNQKPVPAVPVQKSGTS
GVPPMAGGKKPSKRPAWDLKGQLCDLNAELKRCRERTQTLDQENQQLQDQLRDAQQQVKA
LGTERTTLEGHLAKVQAQAEQGQQELKNLRACVLELEERLSTQEGLVQELQKKQVELQEE
RRGLMSQLEEKERRLQTSEAALSSSQAEVASLRQETVAQAALLTEREERLHGLEMERRRL
HNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSLSRSDERRGTL
SGAPAPPTRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTM
EGGPGGDPQLEGLIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKG
QGGECEIRRAGPGSEELTVTNARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHS
VFQLQISGEHSSRGLQCGAPLSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLG
LVIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKV
NQCVIGTAQANRK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggatccgcagaggtcccccctattggaagtaaaggggaacatagaactgaagagacct
ctgattaaggccccttcccagctgcctctctcaggaagcagactcaagaggaggcctgac
cagatggaagatggcctggagcctgagaagaaacggacaagaggcctgggtgcaacgacc
aaaattaccacatcccacccaagagttccatccctcactacagtgccacagacacaaggc
cagaccacagctcaaaaagtttccaagaagacaggaccccggtgttccacagctattgcc
acagggttgaagaaccagaagccagttcctgctgttcctgtccagaagtctggcacatca
ggtgttcctcccatggcaggagggaagaaacccagcaaacgtccagcctgggacttaaag
ggtcagttatgtgacctaaatgcagaactaaaacggtgccgtgagaggactcaaacgttg
gaccaagagaaccagcagcttcaggaccagctcagagatgcccagcagcaggtcaaggcc
ctggggacagagcgcacaacactggaggggcatttagccaaggtacaggcccaggctgag
cagggccaacaggagctgaagaacttgcgtgcttgtgtcctggagctggaagagcggctg
agcacgcaggagggcttggtgcaagagcttcagaaaaaacaggtggaattgcaggaagaa
cggaggggactgatgtcccaactagaggagaaggagaggaggctgcagacatcagaagca
gccctgtcaagcagccaagcagaggtggcatctctgcggcaggagactgtggcccaggca
gccttactgactgagcgggaagaacgtcttcatgggctagaaatggagcgccggcgactg
cacaaccagctgcaggaactcaagggcaacatccgtgtattctgccgggtccgccctgtc
ctgccgggggagcccactccaccccctggcctcctcctgtttccctctggccctggtggg
ccctctgatcctccaacccgccttagcctctcccggtctgacgagcggcgtgggaccctg
agtggggcaccagctcccccaactcgccatgatttttcctttgaccgggtattcccacca
ggaagtggacaggatgaagtgtttgaagagattgccatgcttgtccagtcagccctggat
ggctatccagtatgcatctttgcctatggccagacaggcagtggcaagaccttcacaatg
gagggtgggcctgggggagacccccagttggaggggctgatccctcgggccctgcggcac
ctcttctctgtggctcaggagctgagtggtcagggctggacctacagctttgtagcaagc
tacgtagagatctacaatgagactgtccgggacctgctggccactggaacccggaagggt
caagggggcgagtgtgagattcgccgtgcagggccagggagtgaggagctcactgtcacc
aatgctcgatatgtccctgtctcctgtgagaaagaagtggacgccctgcttcatctggcc
cgccagaatcgggctgtggcccgcacagcccagaatgaacggtcatcacgcagccacagt
gtattccagctacagatttctggggagcactccagccgaggcctgcagtgtggggccccc
ctcagtcttgtggacctggccgggagtgagcgacttgaccccggcttagccctcggcccc
ggggagcgggaacgccttcgggaaacacaggccattaacagcagcctgtccacgctgggg
ctggttatcatggccctgagcaacaaggagtcccacgtgccttaccggaacagcaaactg
acctacctgctgcagaactctctgggtggtagtgctaagatgctcatgtttgtgaacatt
tctccactggaagagaacgtctccgagtccctcaactctctacgctttgcctccaaggtg
aaccagtgtgttattggtactgctcaggccaacaggaagtga

DBGET integrated database retrieval system