KEGG   Homo sapiens (human): 3836Help
Entry
3836              CDS       T01001                                 

Gene name
KPNA1, IPOA5, NPI-1, RCH2, SRP1
Definition
(RefSeq) karyopherin subunit alpha 1
  KO
K15042  importin subunit alpha-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05164 Influenza A
    3836 (KPNA1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    3836 (KPNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm IBB Arm_3 HEAT_2 HEAT_EZ HEAT RICTOR_V V-ATPase_H_C Arm_2 Atx10homo_assoc V-ATPase_H_N FmdE
Motif
Other DBs
NCBI-GeneID: 3836
NCBI-ProteinID: NP_002255
OMIM: 600686
HGNC: 6394
Ensembl: ENSG00000114030
Vega: OTTHUMG00000159487
Pharos: P52294(Tbio)
UniProt: P52294
Structure
PDB: 

Position
3q21.1
AA seq 538 aa AA seqDB search
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEE
VMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDE
VISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSS
EFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLC
RGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACW
TISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDK
IEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccaggaaaagagaactttcgcctgaaaagttacaagaacaaatctctgaat
cccgatgagatgcgcaggaggagggaggaagaaggactgcagttacgaaagcagaaaaga
gaagagcagttattcaagcggagaaatgttgctacagcagaagaagaaacagaagaagaa
gttatgtcagatggaggctttcatgaggctcagattagtaacatggagatggcaccaggt
ggtgtcatcacttctgacatgattgaaatgatattttccaaaagcccagagcaacagctt
tcagcaacacagaaattcaggaagctgctttcaaaagaacctaaccctcctattgatgaa
gttatcagcacaccaggagtagtggccaggtttgtggagttcctcaaacgaaaagagaat
tgtacactgcagtttgaatcagcttgggtactgacaaatattgcttcaggaaattctctt
cagacccgaattgtgattcaggcaggagctgtgcccatcttcatagagttgctcagctca
gagtttgaagatgtccaggaacaggcagtctgggctcttggcaacattgctggagatagt
accatgtgcagggactatgtcttagactgcaatatccttccccctcttttgcagttattt
tcaaagcaaaaccgcctgaccatgacccggaatgcagtatgggctttgtctaatctctgt
agagggaaaagtccacctccagaatttgcaaaggtttctccatgtctgaatgtgctttcc
tggttgctgtttgtcagtgacactgatgtactggctgatgcctgctgggccctctcatat
ctatcagatggacccaatgataaaattcaagcggtcatcgatgcgggagtatgtaggaga
cttgtggaactgctgatgcataatgattataaagtggtttctcctgctttgcgagctgtg
ggaaacattgtcacaggggatgatattcagacacaggtaattctgaattgctcagctctg
cagagtttattgcatttgctgagtagcccaaaggaatctatcaaaaaggaagcatgttgg
acgatatctaatattacagctggaaatagggcacagatccagactgtgatagatgccaac
attttcccagccctcattagtattttacaaactgctgaatttcggacaagaaaagaagca
gcttgggccatcacaaatgcaacttctggaggatcagctgaacagatcaagtacctagta
gaactgggttgtatcaagccgctctgtgatctcctcacggtcatggactctaagattgta
caggttgccctaaatggcttggaaaatatcctgaggcttggagaacaggaagccaaaagg
aatggcactggcattaacccttactgtgctttgattgaagaagcttatggtctggataaa
attgagttcttacagagtcatgaaaaccaggagatctaccaaaaggcctttgatcttatt
gagcattacttcgggaccgaagatgaagacagcagcattgcaccccaggttgaccttaac
cagcagcagtacatcttccaacagtgtgaggctcctatggaaggtttccagctttga

DBGET integrated database retrieval system