KEGG   Homo sapiens (human): 3839Help
Entry
3839              CDS       T01001                                 

Gene name
KPNA3, IPOA4, SRP1, SRP1gamma, SRP4, hSRP1
Definition
(RefSeq) karyopherin subunit alpha 3
  KO
K23583   
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT_EZ Arm_3 IBB HEAT_2 HEAT Adaptin_N Cnd1 V-ATPase_H_N Mo25 DCB
Motif
Other DBs
NCBI-GeneID: 3839
NCBI-ProteinID: NP_002258
OMIM: 601892
HGNC: 6396
Ensembl: ENSG00000102753
Vega: OTTHUMG00000016922
Pharos: O00505(Tbio)
UniProt: O00505 A0A024RDV7
Position
13q14.2
AA seq 521 aa AA seqDB search
MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDS
DVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
KCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVIVNLCRNKDPPPPMETV
QEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLL
SVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEI
IDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaaccccagcttggagaaccaccgcatcaagagcttcaagaacaagggccgc
gatgtggaaacaatgcgaagacatagaaatgaagtgacagtggaactgcggaagaacaaa
agagatgaacacttattgaaaaagagaaatgttccccaagaagaaagtctagaagattca
gatgttgatgctgattttaaagcacaaaatgtaaccctagaagctatattgcagaatgcc
acaagtgataacccagtggtccaattgagtgctgtccaggcagcaagaaaactgttatcc
agtgacagaaatccaccgattgatgacttaataaaatctgggattttaccaattctagtc
aaatgtctagaaagggatgataatccttcattacagtttgaagctgcttgggcattaact
aacatagcatcaggaacttctgcacagactcaagctgttgtgcagtctaatgcagtacct
ctttttctgagacttcttcgttcaccacatcagaatgtttgtgaacaagcagtatgggct
ttgggaaacattataggtgatggtcctcaatgtagagattatgtcatatcactgggagtt
gtcaaacctcttctgtccttcatcagtccctccatccccatcaccttccttcggaacgtc
acatgggtcattgtcaatctctgcaggaataaggatcccccgccgcctatggagacagtt
caggagattttgccagctttatgtgtcctcatataccatacagatataaacattcttgta
gacactgtttgggctctgtcatacttgacagatggaggtaatgaacagatacagatggtt
attgattcaggagttgtgccctttcttgtgccccttctgagccatcaggaagtcaaagtt
caaacagcagccctcagagcagttggcaacatagtgactggcaccgacgagcagacccag
gttgttctcaattgtgatgtcctgtcacacttcccaaatctcttatcacacccaaaagag
aagataaataaggaagcagtgtggttcctttccaacataacagcaggcaaccagcaacaa
gttcaagctgtaatagatgctggattaattcctatgataattcatcagcttgctaagggg
gactttggaacacaaaaagaagctgcttgggcaatcagcaacttaacaataagtggcaga
aaagatcaggttgagtaccttgtacagcagaatgtaataccaccgttctgtaatttactg
tcagtgaaagattctcaagtggttcaggtggttctagatggtctaaaaaacattctgata
atggccggtgatgaagcaagcacaatagctgaaataatagaggaatgtggaggtttggag
aaaattgaagttttacagcaacatgaaaatgaagacatatataaattagcatttgaaatc
atagatcagtatttctctggtgatgatattgatgaagatccctgcctcattcctgaagca
acacaaggaggtacctacaattttgatccaacagccaaccttcaaacaaaagaatttaat
ttttaa

DBGET integrated database retrieval system