KEGG   Homo sapiens (human): 384Help
Entry
384               CDS       T01001                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
hsa05146  Amoebiasis
Module
hsa_M00029  Urea cycle
hsa_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    384 (ARG2)
   00330 Arginine and proline metabolism
    384 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    384 (ARG2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     384 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 384
NCBI-ProteinID: NP_001163
OMIM: 107830
HGNC: 664
Ensembl: ENSG00000081181
Vega: OTTHUMG00000171807
Pharos: P78540(Tchem)
UniProt: P78540 A0A024R6A0
Structure
PDB: 

Position
14q24.1
AA seq 354 aa AA seqDB search
MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctaaggggcagcctctcgcgtctcctccagacgcgagtgcattccatcctgaag
aaatccgtccactccgtggctgtgataggagccccgttctcacaagggcagaaaagaaaa
ggagtggagcatggtcccgctgccataagagaagctggcttgatgaaaaggctctccagt
ttgggctgccacctaaaagactttggagatttgagttttactccagtccccaaagatgat
ctctacaacaacctgatagtgaatccacgctcagtgggtcttgccaaccaggaactggct
gaggtggttagcagagctgtgtcagatggctacagctgtgtcacactgggaggagaccac
agcctggcaatcggtaccattagtggccatgcccgacactgcccagacctttgtgttgtc
tgggttgatgcccatgctgacatcaacacaccccttaccacttcatcaggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggataaggtaccacaactcccagga
ttttcctggatcaaaccttgtatctcttctgcaagtattgtgtatattggtctgagagac
gtggaccctcctgaacattttattttaaagaactatgatatccagtatttttccatgaga
gatattgatcgacttggtatccagaaggtcatggaacgaacatttgatctgctgattggc
aagagacaaagaccaatccatttgagttttgatattgatgcatttgaccctacactggct
ccagccacaggaactcctgttgtcgggggactaacctatcgagaaggcatgtatattgct
gaggaaatacacaatacagggttgctatcagcactggatcttgttgaagtcaatcctcag
ttggccacctcagaggaagaggcgaagactacagctaacctggcagtagatgtgattgct
tcaagctttggtcagacaagagaaggagggcatattgtctatgaccaacttcctactccc
agttcaccagatgaatcagaaaatcaagcacgtgtgagaatttag

DBGET integrated database retrieval system