KEGG   Homo sapiens (human): 3840Help
Entry
3840              CDS       T01001                                 

Gene name
KPNA4, IPOA3, QIP1, SRP3
Definition
(RefSeq) karyopherin subunit alpha 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Arm_3 IBB HEAT_EZ HEAT_2 HEAT Adaptin_N V-ATPase_H_C Cnd1 V-ATPase_H_N Arm_2 Atx10homo_assoc DRIM Mo25
Motif
Other DBs
NCBI-GeneID: 3840
NCBI-ProteinID: NP_002259
OMIM: 602970
HGNC: 6397
Ensembl: ENSG00000186432
Vega: OTTHUMG00000159033
Pharos: O00629(Tbio)
UniProt: O00629
Structure
PDB: 

Position
3q25.33
AA seq 521 aa AA seqDB search
MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDS
DIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
HCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETI
QEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL
TVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEI
IDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaacgagaaactggacaaccaacggctcaagaatttcaagaacaaaggccgc
gacttggagactatgagaagacaacgaaatgaagttgtagttgaattaaggaagaataaa
agagatgaacatctcttaaagagaaggaatgtaccacatgaagatatctgtgaagactct
gatatagatggtgattatagagtgcaaaatacctctctagaagctattgttcaaaatgct
tcaagtgataaccaaggaattcaattaagtgcagttcaagctgctaggaagcttttgtcc
agtgatcgaaatccaccaattgatgacttaataaaatctggaatattgcccattttagtc
cattgtcttgaaagagatgacaatccttctttacagtttgaagctgcatgggctttgaca
aacattgcatctggaacttctgaacaaactcaagcagtagttcagtccaatgctgtgcca
cttttcctgaggcttctccattcaccccatcagaatgtctgtgagcaagcagtgtgggca
ttgggaaatatcataggtgatgggccccagtgtagagattatgtcataagtcttggagtt
gtgaaacctttactttccttcataagtccatctattcctataacattcttaagaaatgtt
acttgggttatggtcaacttatgtcgccacaaagacccaccaccaccaatggaaaccatt
caggagattcttccagccctttgtgttttaattcatcacacagatgtaaatatactggta
gacacagtctgggccctctcttaccttactgatgctggcaatgaacaaatacagatggta
atagactctggaatagttcctcatttggttcctctgctcagccaccaggaagttaaagtt
cagactgctgcacttagagctgtgggcaacattgttactggaactgatgagcaaacacaa
gtagttttgaactgtgatgctctttcacacttcccagcactcctgacacatcccaaagag
aaaattaataaagaagcagtgtggttcctctccaacatcactgcaggaaatcagcagcag
gtacaggcagtaattgatgccaatcttgtaccaatgataatacaccttttggataagggg
gattttggcactcaaaaagaagctgcttgggccataagtaacttaacaattagtggaagg
aaagatcaagtggcttaccttatccaacaaaatgttatcccacctttttgcaacttgctg
actgtaaaagatgcacaagttgtgcaagtagtactcgatggactaagtaatatattaaaa
atggctgaagatgaggcagaaaccataggcaatcttatagaagaatgtggagggctggag
aaaattgaacaacttcaaaatcatgaaaatgaagacatctacaaattggcctatgagatc
attgatcagttcttctcttcagatgatattgatgaagaccctagccttgttccagaggca
attcaaggcggaacatttggtttcaattcatctgccaatgtaccaacagaagggttccag
ttttag

DBGET integrated database retrieval system