KEGG   Homo sapiens (human): 3841Help
Entry
3841              CDS       T01001                                 

Gene name
KPNA5, IPOA6, SRP6
Definition
(RefSeq) karyopherin subunit alpha 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm IBB HEAT_EZ HEAT_2 Arm_3 HEAT V-ATPase_H_C RICTOR_V Adaptin_N Arm_2 V-ATPase_H_N Atx10homo_assoc DUF3818 Mo25
Motif
Other DBs
NCBI-GeneID: 3841
NCBI-ProteinID: NP_002260
OMIM: 604545
HGNC: 6398
Ensembl: ENSG00000196911
Vega: OTTHUMG00000015448
Pharos: O15131(Tdark)
UniProt: O15131
Structure
PDB: 

Position
6q22.1
AA seq 539 aa AA seqDB search
MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDE
SMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPID
QVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLN
SEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNL
CRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCR
RLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEAC
WTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYL
VALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLD
KIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatggctagtccagggaaagataactatagaatgaaaagttataagaataaa
gccctaaatcctcaagagatgcgtagacgaagagaagaagaaggaatacagcttagaaaa
caaaaaagagaagaacagttgttcaaacgcagaaatgtctatttgcccagaaatgatgaa
tctatgcttgaaagtcctatacaggatccagatattagttccactgtacccattccagag
gaagaagttgttactacagatatggttcagatgattttttctaataatgctgatcaacag
ctaacagcaacacagaaatttagaaagctgctttctaaagaacctaatccaccaatagat
caagttatacagaaaccaggagttgtacagagatttgtgaaatttcttgaaagaaatgaa
aattgcactttacaatttgaagctgcatgggcattaacaaatatagcatctggaactttt
ctgcataccaaggtagtgattgaaactggggctgttccgatttttatcaaacttcttaat
tctgaacatgaagatgttcaggaacaggctgtttgggcacttggtaatattgctggtgac
aatgcagaatgcagagattttgttttgaattgtgaaatacttccacctcttttagagtta
ttaacaaattcaaacagactcacaacaacaagaaatgccgtgtgggccctctcaaattta
tgtagaggcaaaaaccctcctccaaactttagtaaggtttcaccttgcttaaatgtcctg
tcacgactgttgtttagcagtgacccagatgtgttagcagacgtgtgttgggccctttct
tatctctccgatggacccaatgataaaattcaagcagtcattgattctggagtctgtcga
agattggtggaacttttgatgcacaatgattataaagttgtatcacctgcattaagggca
gttggtaatattgtgactggtgatgatattcaaacacaggtaattttgaattgttctgca
ttaccctgtctcttacatttattgagtagcccaaaggagtcaattagaaaagaagcctgc
tggactgtttctaacatcactgctggaaatagagctcagattcaggctgttatagatgca
aatatttttcctgttttgattgagattcttcagaaagcagagtttcgtaccagaaaagaa
gcagcttgggctataactaatgcaacatcaggaggtactccagagcaaataaggtatttg
gtagctttaggctgcattaaaccactttgtgatcttttgactgttatggactccaaaata
gtccaagtggctttaaatggacttgaaaatattttacgtcttggagaacaagaatctaag
cagaatggaataggcattaatccatactgtgctctcattgaagaagcatatggtctggat
aaaattgagtttttgcaaagccatgaaaatcaggaaatttaccagaaggcatttgatctg
attgaacattactttggtgtagaagaagatgaccccagcattgtacctcaggtggatgaa
aaccaacaacagtttatatttcagcagcaggaagcaccaatggatggatttcaactttaa

DBGET integrated database retrieval system