KEGG   Homo sapiens (human): 3841
Entry
3841              CDS       T01001                                 

Gene name
KPNA5, IPOA6, SRP6
Definition
(RefSeq) karyopherin subunit alpha 5
  KO
K15042  importin subunit alpha-6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    3841 (KPNA5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3841 (KPNA5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    3841 (KPNA5)
SSDB
Motif
Pfam: Arm IBB HEAT_EZ Arm_3 HEAT_2 HEAT V-ATPase_H_C Adaptin_N RICTOR_V Arm_2 V-ATPase_H_N DUF3818
Other DBs
NCBI-GeneID: 3841
NCBI-ProteinID: NP_002260
OMIM: 604545
HGNC: 6398
Ensembl: ENSG00000196911
Vega: OTTHUMG00000015448
Pharos: O15131(Tdark)
UniProt: O15131
Structure
PDB: 
4U2X

Position
6q22.1
AA seq 539 aa
MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDE
SMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPID
QVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLN
SEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNL
CRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCR
RLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEAC
WTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYL
VALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLD
KIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggatgccatggctagtccagggaaagataactatagaatgaaaagttataagaataaa
gccctaaatcctcaagagatgcgtagacgaagagaagaagaaggaatacagcttagaaaa
caaaaaagagaagaacagttgttcaaacgcagaaatgtctatttgcccagaaatgatgaa
tctatgcttgaaagtcctatacaggatccagatattagttccactgtacccattccagag
gaagaagttgttactacagatatggttcagatgattttttctaataatgctgatcaacag
ctaacagcaacacagaaatttagaaagctgctttctaaagaacctaatccaccaatagat
caagttatacagaaaccaggagttgtacagagatttgtgaaatttcttgaaagaaatgaa
aattgcactttacaatttgaagctgcatgggcattaacaaatatagcatctggaactttt
ctgcataccaaggtagtgattgaaactggggctgttccgatttttatcaaacttcttaat
tctgaacatgaagatgttcaggaacaggctgtttgggcacttggtaatattgctggtgac
aatgcagaatgcagagattttgttttgaattgtgaaatacttccacctcttttagagtta
ttaacaaattcaaacagactcacaacaacaagaaatgccgtgtgggccctctcaaattta
tgtagaggcaaaaaccctcctccaaactttagtaaggtttcaccttgcttaaatgtcctg
tcacgactgttgtttagcagtgacccagatgtgttagcagacgtgtgttgggccctttct
tatctctccgatggacccaatgataaaattcaagcagtcattgattctggagtctgtcga
agattggtggaacttttgatgcacaatgattataaagttgtatcacctgcattaagggca
gttggtaatattgtgactggtgatgatattcaaacacaggtaattttgaattgttctgca
ttaccctgtctcttacatttattgagtagcccaaaggagtcaattagaaaagaagcctgc
tggactgtttctaacatcactgctggaaatagagctcagattcaggctgttatagatgca
aatatttttcctgttttgattgagattcttcagaaagcagagtttcgtaccagaaaagaa
gcagcttgggctataactaatgcaacatcaggaggtactccagagcaaataaggtatttg
gtagctttaggctgcattaaaccactttgtgatcttttgactgttatggactccaaaata
gtccaagtggctttaaatggacttgaaaatattttacgtcttggagaacaagaatctaag
cagaatggaataggcattaatccatactgtgctctcattgaagaagcatatggtctggat
aaaattgagtttttgcaaagccatgaaaatcaggaaatttaccagaaggcatttgatctg
attgaacattactttggtgtagaagaagatgaccccagcattgtacctcaggtggatgaa
aaccaacaacagtttatatttcagcagcaggaagcaccaatggatggatttcaactttaa

DBGET integrated database retrieval system