KEGG   Homo sapiens (human): 3851
Entry
3851              CDS       T01001                                 

Symbol
KRT4, CK-4, CK4, CYK4, K4, WSN1
Name
(RefSeq) keratin 4
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00724  White sponge nevus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3851 (KRT4)
   04147 Exosome [BR:hsa04147]
    3851 (KRT4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3851 (KRT4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3851 (KRT4)
  Exosomal proteins of other body fluids (saliva and urine)
   3851 (KRT4)
  Exosomal proteins of colorectal cancer cells
   3851 (KRT4)
  Exosomal proteins of bladder cancer cells
   3851 (KRT4)
SSDB
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip Spc7 TPR_MLP1_2 Jnk-SapK_ap_N SCO1-SenC DUF1664 DUF812 ATG16 SOGA Bap31_Bap29_C Golgin_A5 Crescentin
Other DBs
NCBI-GeneID: 3851
NCBI-ProteinID: NP_002263
OMIM: 123940
HGNC: 6441
Ensembl: ENSG00000170477
Vega: OTTHUMG00000169800
UniProt: P19013
Position
12q13.13
AA seq 520 aa
MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKS
ISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLT
PLHVEIDPEIQKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTS
SKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAEND
FVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNR
NLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQLQISVDQHGDNLKNTKSEIAELNR
MIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKRVELEAALQQAKEELARMLR
EYQELMSVKLALDIEIATYRKLLEGEEYRMSGECQSAVSISVVSGSTSTGGISGGLGSGS
GFGLSSGFGSGSGSGFGFGGSVSGSSSSKIISTTTLNKRR
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgattgccagacagcagtgtgtccgaggcgggccccggggcttcagctgtggctcggcc
attgtaggcggtggcaagagaggtgccttcagctcagtctccatgtctggaggtgctggc
cgatgctcttctgggggatttggcagcagaagcctctacaacctcagggggaacaaaagc
atctccatgagtgtggctgggtcacgacaaggtgcctgctttgggggtgctggaggcttt
ggcactggtggctttggtggtggatttgggggctccttcagtggtaagggtggccctggc
ttccccgtctgccccgctgggggaattcaggaggtcaccatcaaccagagcttgctcacc
cccctccacgtggagattgaccctgagatccagaaagtccggacggaagagcgcgaacag
atcaagctcctcaacaacaagtttgcctccttcatcgacaaggtgcagttcttagagcaa
cagaataaggtcctggagaccaaatggaacctgctccagcagcagacgaccaccacctcc
agcaaaaaccttgagcccctctttgagacctacctcagtgtcctgaggaagcagctagat
accttgggcaatgacaaagggcgcctgcagtctgagctgaagaccatgcaggacagcgtg
gaggacttcaagactaagtatgaagaggagatcaacaaacgcacagcagccgagaatgac
tttgtggtcctaaagaaggacgtggatgctgcctacctgaacaaggtggagttggaggcc
aaggtggacagtcttaatgacgagatcaacttcctgaaggtcctctatgatgcggagctg
tcccagatgcagacccatgtcagcgacacgtccgtggtcctttccatggacaacaaccgc
aacctggacctggacagcattattgccgaggtccgtgcccagtacgaggagattgcccag
aggagcaaggctgaggctgaagccctgtaccagaccaaggtccagcagctccagatctcg
gttgaccaacatggtgacaacctgaagaacaccaagagtgaaattgcagagctcaacagg
atgatccagaggctgcgggcagagatcgagaacatcaagaagcagtgccagactcttcag
gtatccgtggctgatgcagagcagcgaggtgagaatgcccttaaagatgcccacagcaag
cgcgtagagctggaggctgccctgcagcaggccaaggaggagctggcacgaatgctgcgt
gagtaccaggagctcatgagtgtgaagctggccttggacatcgagatcgccacctaccgc
aaactgctggagggcgaggagtacagaatgtctggagaatgccagagtgccgtgagcatc
tctgtggtcagcggtagcaccagcactggaggcatcagcggaggattaggaagtggctcc
gggtttggcctgagtagtggctttggctccggctctggaagtggctttgggtttggtggc
agtgtctctggcagttccagcagcaagatcatctctaccaccaccctgaacaagagacga
tag

DBGET integrated database retrieval system